Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7I5L9

Protein Details
Accession W7I5L9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
39-61DQKQHTYKQHSSQRKRHHSSFSPHydrophilic
NLS Segment(s)
PositionSequence
68-72KPSRK
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MAHFKPTQRKNGGIVLSMRANFDLAVPDTAAPAVDPPVDQKQHTYKQHSSQRKRHHSSFSPPAAAGAKPSRKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.34
4 0.31
5 0.27
6 0.2
7 0.18
8 0.14
9 0.13
10 0.12
11 0.1
12 0.1
13 0.09
14 0.09
15 0.09
16 0.09
17 0.08
18 0.06
19 0.05
20 0.04
21 0.04
22 0.04
23 0.07
24 0.11
25 0.13
26 0.13
27 0.16
28 0.23
29 0.31
30 0.37
31 0.42
32 0.43
33 0.51
34 0.61
35 0.68
36 0.71
37 0.72
38 0.77
39 0.81
40 0.84
41 0.81
42 0.8
43 0.77
44 0.76
45 0.77
46 0.71
47 0.63
48 0.55
49 0.51
50 0.44
51 0.37
52 0.34
53 0.33