Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7I0A7

Protein Details
Accession W7I0A7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-86STSNEANQAKPKKKKKKVRFKLRESPRRKLPTSHydrophilic
NLS Segment(s)
PositionSequence
63-93KPKKKKKKVRFKLRESPRRKLPTSVPAHSKK
Subcellular Location(s) extr 8, mito 5, plas 5, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTPLDSLPIIYAEHLLAVLLLCFGALTFLLVCRSRAAVSSSSGAADDVESSILSTSNEANQAKPKKKKKKVRFKLRESPRRKLPTSVPAHSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.04
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.04
16 0.07
17 0.08
18 0.09
19 0.09
20 0.11
21 0.1
22 0.12
23 0.14
24 0.12
25 0.13
26 0.14
27 0.14
28 0.13
29 0.12
30 0.11
31 0.08
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.06
44 0.12
45 0.12
46 0.13
47 0.21
48 0.3
49 0.38
50 0.48
51 0.58
52 0.64
53 0.74
54 0.84
55 0.87
56 0.9
57 0.93
58 0.94
59 0.94
60 0.93
61 0.93
62 0.93
63 0.93
64 0.89
65 0.88
66 0.86
67 0.84
68 0.77
69 0.73
70 0.69
71 0.69
72 0.7
73 0.68