Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7I6T1

Protein Details
Accession W7I6T1    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKQENKRGKRSQPNSSLSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR037212  Med7/Med21-like  
IPR011425  Med9  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF07544  Med9  
Amino Acid Sequences MPKQENKRGKRSQPNSSLSATAGGQSSRTADELEAIVENTLLKKASESKDAPKMEPAPEPSSLASILAGPAPPTFPPPETFDFIPQTHDLLQRLLPAAEQSPGATANGLAPLEPKDVDAEASRIRLKIQKARAIISEMPDIERTIDEQEEEIKALEAKIKKQKEVLGGVRHLKAVKNAAAALKASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.76
3 0.68
4 0.59
5 0.49
6 0.43
7 0.32
8 0.23
9 0.19
10 0.15
11 0.13
12 0.12
13 0.13
14 0.12
15 0.12
16 0.11
17 0.1
18 0.11
19 0.11
20 0.11
21 0.1
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.08
28 0.07
29 0.07
30 0.08
31 0.15
32 0.18
33 0.25
34 0.28
35 0.33
36 0.41
37 0.44
38 0.43
39 0.41
40 0.42
41 0.37
42 0.38
43 0.36
44 0.31
45 0.29
46 0.3
47 0.24
48 0.22
49 0.2
50 0.16
51 0.11
52 0.08
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.06
59 0.06
60 0.08
61 0.1
62 0.1
63 0.12
64 0.16
65 0.19
66 0.22
67 0.22
68 0.23
69 0.25
70 0.24
71 0.25
72 0.2
73 0.18
74 0.17
75 0.18
76 0.16
77 0.14
78 0.14
79 0.12
80 0.12
81 0.11
82 0.09
83 0.07
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.05
97 0.06
98 0.07
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.09
105 0.09
106 0.1
107 0.1
108 0.13
109 0.14
110 0.13
111 0.15
112 0.18
113 0.23
114 0.28
115 0.34
116 0.38
117 0.39
118 0.41
119 0.41
120 0.41
121 0.38
122 0.33
123 0.29
124 0.23
125 0.23
126 0.21
127 0.2
128 0.16
129 0.14
130 0.13
131 0.12
132 0.12
133 0.11
134 0.11
135 0.12
136 0.12
137 0.13
138 0.12
139 0.1
140 0.1
141 0.1
142 0.15
143 0.16
144 0.23
145 0.32
146 0.36
147 0.38
148 0.42
149 0.47
150 0.47
151 0.53
152 0.54
153 0.51
154 0.54
155 0.56
156 0.53
157 0.51
158 0.46
159 0.4
160 0.37
161 0.36
162 0.33
163 0.3
164 0.31
165 0.31
166 0.31