Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7I4G1

Protein Details
Accession W7I4G1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
47-73LPAVQSRSYAKKRKRPQKDPKIRAIDYHydrophilic
166-185FNESWRRPKERVVKKGVKRRBasic
NLS Segment(s)
PositionSequence
56-67AKKRKRPQKDPK
171-185RRPKERVVKKGVKRR
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019192  Ribosomal_L28/L40_mit  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09812  MRP-L28  
Amino Acid Sequences MSISPLHRSVLFSRVHAATTASTTIAAAISPRPSILPSIRNALQSLLPAVQSRSYAKKRKRPQKDPKIRAIDYAFAHPLTPRPLKWSYMRTLRHWTIQQAWLLFKHQQKKERELELERQYNKMHEACEELKRVDERLFRIATDRKGVGTFPAEMRIPTDTPPRDGFNESWRRPKERVVKKGVKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.25
4 0.24
5 0.18
6 0.18
7 0.18
8 0.13
9 0.12
10 0.11
11 0.11
12 0.1
13 0.08
14 0.07
15 0.08
16 0.1
17 0.1
18 0.1
19 0.1
20 0.11
21 0.15
22 0.19
23 0.21
24 0.21
25 0.27
26 0.29
27 0.3
28 0.3
29 0.27
30 0.24
31 0.2
32 0.2
33 0.14
34 0.13
35 0.12
36 0.13
37 0.12
38 0.13
39 0.16
40 0.22
41 0.3
42 0.39
43 0.47
44 0.56
45 0.66
46 0.75
47 0.83
48 0.85
49 0.88
50 0.9
51 0.93
52 0.9
53 0.9
54 0.88
55 0.77
56 0.71
57 0.61
58 0.54
59 0.44
60 0.39
61 0.3
62 0.21
63 0.21
64 0.16
65 0.16
66 0.17
67 0.18
68 0.15
69 0.2
70 0.22
71 0.24
72 0.28
73 0.31
74 0.31
75 0.38
76 0.41
77 0.39
78 0.45
79 0.43
80 0.43
81 0.4
82 0.36
83 0.32
84 0.32
85 0.29
86 0.23
87 0.22
88 0.19
89 0.2
90 0.23
91 0.23
92 0.29
93 0.33
94 0.39
95 0.43
96 0.5
97 0.54
98 0.55
99 0.55
100 0.51
101 0.55
102 0.55
103 0.58
104 0.51
105 0.47
106 0.42
107 0.38
108 0.37
109 0.3
110 0.22
111 0.16
112 0.2
113 0.21
114 0.25
115 0.27
116 0.24
117 0.25
118 0.25
119 0.26
120 0.26
121 0.26
122 0.25
123 0.28
124 0.28
125 0.25
126 0.31
127 0.34
128 0.32
129 0.33
130 0.31
131 0.26
132 0.26
133 0.26
134 0.23
135 0.2
136 0.2
137 0.16
138 0.19
139 0.18
140 0.18
141 0.19
142 0.2
143 0.18
144 0.19
145 0.27
146 0.26
147 0.3
148 0.33
149 0.35
150 0.35
151 0.38
152 0.37
153 0.39
154 0.47
155 0.47
156 0.54
157 0.56
158 0.59
159 0.57
160 0.64
161 0.65
162 0.65
163 0.71
164 0.71
165 0.76