Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HY16

Protein Details
Accession W7HY16    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-71SPALHRARRHHLKRLCYHRSBasic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002052  DNA_methylase_N6_adenine_CS  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0003676  F:nucleic acid binding  
GO:0043414  P:macromolecule methylation  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
PROSITE View protein in PROSITE  
PS00092  N6_MTASE  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MPRLPPSLVTLARSQHSLLPLLLRQTRSLPLARSELRWLREYVFQLPSSISSPALHRARRHHLKRLCYHRSLGAPLQYLLKTQPFGTVEILCGKGALIPRPETEGTVVKLFQTRRNGVAQEGYGLRVLDLCTGPGSIALLAASLLHDSGSPSGYRVLGVDISDRALRLAQQSLTYNIANGALPPAARQNVGFTKLDLLATDHSAALSTIASFFNHDFTSGREPESVVDIIIANPPYISPQGYWKDTSRSVRLYEPELALVPPPLPKPHGSDYLQEDSFYPAIESLATKLRAPGLVLETGGNDQSARVQHMLAQRNWETSIWTDFAGIHRNVVAWRGNGSWSWLGSLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.27
4 0.27
5 0.23
6 0.24
7 0.24
8 0.29
9 0.33
10 0.31
11 0.3
12 0.31
13 0.34
14 0.34
15 0.35
16 0.32
17 0.31
18 0.38
19 0.38
20 0.38
21 0.43
22 0.45
23 0.44
24 0.44
25 0.42
26 0.37
27 0.4
28 0.41
29 0.38
30 0.36
31 0.33
32 0.31
33 0.3
34 0.29
35 0.25
36 0.22
37 0.18
38 0.14
39 0.16
40 0.24
41 0.3
42 0.33
43 0.36
44 0.43
45 0.53
46 0.62
47 0.67
48 0.68
49 0.69
50 0.74
51 0.78
52 0.81
53 0.79
54 0.72
55 0.68
56 0.63
57 0.6
58 0.55
59 0.5
60 0.44
61 0.37
62 0.33
63 0.35
64 0.29
65 0.27
66 0.24
67 0.22
68 0.18
69 0.16
70 0.21
71 0.18
72 0.2
73 0.21
74 0.19
75 0.18
76 0.2
77 0.21
78 0.15
79 0.14
80 0.12
81 0.12
82 0.14
83 0.16
84 0.16
85 0.17
86 0.18
87 0.23
88 0.23
89 0.22
90 0.22
91 0.21
92 0.2
93 0.2
94 0.19
95 0.16
96 0.2
97 0.21
98 0.24
99 0.29
100 0.29
101 0.3
102 0.33
103 0.33
104 0.3
105 0.31
106 0.25
107 0.2
108 0.19
109 0.17
110 0.14
111 0.13
112 0.11
113 0.09
114 0.1
115 0.09
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.04
135 0.04
136 0.05
137 0.05
138 0.06
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.06
148 0.07
149 0.08
150 0.07
151 0.07
152 0.06
153 0.07
154 0.07
155 0.09
156 0.08
157 0.1
158 0.11
159 0.12
160 0.14
161 0.13
162 0.12
163 0.1
164 0.1
165 0.09
166 0.08
167 0.07
168 0.05
169 0.05
170 0.06
171 0.07
172 0.07
173 0.08
174 0.08
175 0.11
176 0.13
177 0.16
178 0.16
179 0.14
180 0.16
181 0.16
182 0.16
183 0.12
184 0.11
185 0.09
186 0.1
187 0.1
188 0.08
189 0.07
190 0.08
191 0.07
192 0.06
193 0.05
194 0.04
195 0.05
196 0.05
197 0.06
198 0.07
199 0.07
200 0.09
201 0.09
202 0.09
203 0.09
204 0.11
205 0.18
206 0.17
207 0.18
208 0.17
209 0.17
210 0.17
211 0.2
212 0.17
213 0.1
214 0.1
215 0.09
216 0.09
217 0.11
218 0.11
219 0.08
220 0.07
221 0.07
222 0.09
223 0.09
224 0.1
225 0.08
226 0.15
227 0.2
228 0.23
229 0.26
230 0.26
231 0.31
232 0.36
233 0.4
234 0.38
235 0.36
236 0.36
237 0.38
238 0.38
239 0.37
240 0.35
241 0.3
242 0.26
243 0.24
244 0.21
245 0.18
246 0.16
247 0.13
248 0.12
249 0.13
250 0.14
251 0.16
252 0.18
253 0.23
254 0.27
255 0.34
256 0.33
257 0.37
258 0.41
259 0.45
260 0.43
261 0.37
262 0.33
263 0.29
264 0.27
265 0.22
266 0.16
267 0.1
268 0.1
269 0.1
270 0.1
271 0.09
272 0.15
273 0.16
274 0.16
275 0.17
276 0.19
277 0.19
278 0.19
279 0.2
280 0.17
281 0.17
282 0.17
283 0.16
284 0.15
285 0.16
286 0.15
287 0.12
288 0.09
289 0.08
290 0.11
291 0.13
292 0.15
293 0.15
294 0.15
295 0.2
296 0.28
297 0.35
298 0.33
299 0.39
300 0.38
301 0.39
302 0.41
303 0.36
304 0.31
305 0.26
306 0.28
307 0.22
308 0.2
309 0.18
310 0.18
311 0.21
312 0.25
313 0.23
314 0.2
315 0.19
316 0.2
317 0.2
318 0.23
319 0.24
320 0.18
321 0.21
322 0.21
323 0.22
324 0.21
325 0.26
326 0.25
327 0.21