Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HZH0

Protein Details
Accession W7HZH0    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-32LDDNAKHQPRRKSGSKPKGSPEHRFTBasic
NLS Segment(s)
PositionSequence
15-25PRRKSGSKPKG
Subcellular Location(s) nucl 17, cyto 4, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020347  Pop8  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0006379  P:mRNA cleavage  
GO:0008033  P:tRNA processing  
Amino Acid Sequences MNSPAALDDNAKHQPRRKSGSKPKGSPEHRFTLRGPEWHYLHLQMTFDPPHPAAFTSPSYPPDPLTWKTRLDAALSIFLGVSGTSIPTDLLDLSGDKLLLRIPREDAPRYMAAIGGWADTVEGRTVGFRILNNSDFLMSVVIAGDSASLFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.64
4 0.66
5 0.68
6 0.75
7 0.81
8 0.84
9 0.82
10 0.82
11 0.84
12 0.83
13 0.81
14 0.76
15 0.74
16 0.67
17 0.64
18 0.56
19 0.55
20 0.52
21 0.48
22 0.46
23 0.43
24 0.41
25 0.4
26 0.4
27 0.32
28 0.29
29 0.26
30 0.22
31 0.16
32 0.17
33 0.17
34 0.16
35 0.17
36 0.16
37 0.15
38 0.15
39 0.15
40 0.13
41 0.14
42 0.15
43 0.15
44 0.16
45 0.18
46 0.19
47 0.19
48 0.19
49 0.19
50 0.22
51 0.22
52 0.25
53 0.25
54 0.25
55 0.25
56 0.26
57 0.24
58 0.21
59 0.2
60 0.16
61 0.15
62 0.13
63 0.13
64 0.1
65 0.09
66 0.08
67 0.06
68 0.05
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.06
81 0.06
82 0.06
83 0.05
84 0.06
85 0.08
86 0.1
87 0.11
88 0.12
89 0.15
90 0.2
91 0.25
92 0.27
93 0.26
94 0.28
95 0.28
96 0.27
97 0.25
98 0.2
99 0.15
100 0.14
101 0.13
102 0.09
103 0.07
104 0.06
105 0.06
106 0.06
107 0.07
108 0.05
109 0.05
110 0.05
111 0.06
112 0.07
113 0.08
114 0.1
115 0.1
116 0.15
117 0.19
118 0.2
119 0.21
120 0.22
121 0.21
122 0.19
123 0.19
124 0.14
125 0.1
126 0.08
127 0.07
128 0.06
129 0.06
130 0.05
131 0.05