Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7I7B6

Protein Details
Accession W7I7B6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-131LPTPQPQRPPRVLRPPDRQRSKKMAKGMHydrophilic
NLS Segment(s)
PositionSequence
114-129RVLRPPDRQRSKKMAK
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MKPGLRQLEIRYSREAGGDAATTANVPRTAWRKGADDEEEEGEGTGPAAGNAGGRRTAGPNDRTVRARFLRRPVAPLLGLPPLPRLTPLPHRHTSQPILPPTALPTPQPQRPPRVLRPPDRQRSKKMAKGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.24
4 0.19
5 0.16
6 0.12
7 0.1
8 0.09
9 0.09
10 0.08
11 0.1
12 0.09
13 0.09
14 0.14
15 0.18
16 0.21
17 0.25
18 0.28
19 0.29
20 0.31
21 0.36
22 0.34
23 0.32
24 0.31
25 0.28
26 0.26
27 0.22
28 0.19
29 0.14
30 0.11
31 0.08
32 0.06
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.07
42 0.07
43 0.09
44 0.12
45 0.16
46 0.18
47 0.23
48 0.26
49 0.29
50 0.31
51 0.3
52 0.33
53 0.32
54 0.37
55 0.34
56 0.38
57 0.44
58 0.41
59 0.44
60 0.4
61 0.38
62 0.32
63 0.28
64 0.23
65 0.17
66 0.17
67 0.13
68 0.14
69 0.12
70 0.12
71 0.13
72 0.12
73 0.15
74 0.25
75 0.32
76 0.38
77 0.41
78 0.44
79 0.46
80 0.51
81 0.5
82 0.46
83 0.46
84 0.42
85 0.41
86 0.38
87 0.35
88 0.33
89 0.33
90 0.28
91 0.22
92 0.28
93 0.31
94 0.36
95 0.45
96 0.46
97 0.5
98 0.58
99 0.66
100 0.67
101 0.72
102 0.75
103 0.76
104 0.82
105 0.85
106 0.87
107 0.89
108 0.86
109 0.84
110 0.86
111 0.86