Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HXR9

Protein Details
Accession W7HXR9   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
140-160EGNAEKDKRRREERERRKLEGBasic
168-188GEEAEGKRRRRQDRRHGIEAABasic
NLS Segment(s)
PositionSequence
143-160AEKDKRRREERERRKLEG
171-182AEGKRRRRQDRR
Subcellular Location(s) mito 12, cyto 9, nucl 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR002905  Trm1  
IPR042296  tRNA_met_Trm1_C  
Gene Ontology GO:0004809  F:tRNA (guanine-N2-)-methyltransferase activity  
GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF02005  TRM  
PROSITE View protein in PROSITE  
PS51626  SAM_MT_TRM1  
Amino Acid Sequences MPTQLSRVLHCDAPPLAAIRGALLGLGYRVSKSHCRPGSLKTDASWRVLWRVMRAWVRTHPIKPGSLTESMPGYRILYPRTQHPDDEHENLDEIVFDEALGREKEKGKGEVNYQLNPNAYWGPMARAGRRGMTAQELSKEGNAEKDKRRREERERRKLEGLTRVADNGEEAEGKRRRRQDRRHGIEAAAAASSSVDVSDRRDCGNGVEETPVRTNTTDGAQYGLAGISASDLDRLEEEAVGKLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.19
4 0.17
5 0.17
6 0.12
7 0.12
8 0.1
9 0.09
10 0.07
11 0.06
12 0.05
13 0.07
14 0.07
15 0.07
16 0.08
17 0.13
18 0.21
19 0.26
20 0.36
21 0.39
22 0.44
23 0.46
24 0.52
25 0.57
26 0.54
27 0.5
28 0.41
29 0.46
30 0.43
31 0.44
32 0.4
33 0.33
34 0.31
35 0.33
36 0.33
37 0.28
38 0.29
39 0.32
40 0.35
41 0.36
42 0.36
43 0.37
44 0.43
45 0.45
46 0.43
47 0.44
48 0.41
49 0.41
50 0.39
51 0.37
52 0.34
53 0.31
54 0.3
55 0.24
56 0.24
57 0.22
58 0.21
59 0.17
60 0.15
61 0.15
62 0.17
63 0.18
64 0.2
65 0.21
66 0.28
67 0.35
68 0.35
69 0.34
70 0.35
71 0.4
72 0.39
73 0.42
74 0.35
75 0.28
76 0.27
77 0.25
78 0.22
79 0.14
80 0.1
81 0.07
82 0.05
83 0.05
84 0.05
85 0.05
86 0.07
87 0.08
88 0.08
89 0.1
90 0.12
91 0.17
92 0.19
93 0.22
94 0.22
95 0.25
96 0.27
97 0.33
98 0.33
99 0.31
100 0.3
101 0.28
102 0.26
103 0.23
104 0.22
105 0.14
106 0.11
107 0.09
108 0.09
109 0.08
110 0.12
111 0.14
112 0.13
113 0.16
114 0.17
115 0.17
116 0.18
117 0.17
118 0.14
119 0.16
120 0.17
121 0.14
122 0.15
123 0.15
124 0.14
125 0.14
126 0.14
127 0.1
128 0.15
129 0.18
130 0.22
131 0.29
132 0.37
133 0.44
134 0.5
135 0.58
136 0.61
137 0.69
138 0.75
139 0.78
140 0.81
141 0.81
142 0.79
143 0.75
144 0.7
145 0.65
146 0.62
147 0.54
148 0.45
149 0.39
150 0.34
151 0.29
152 0.25
153 0.2
154 0.11
155 0.09
156 0.08
157 0.07
158 0.16
159 0.21
160 0.25
161 0.31
162 0.39
163 0.49
164 0.59
165 0.69
166 0.72
167 0.78
168 0.83
169 0.84
170 0.77
171 0.67
172 0.6
173 0.5
174 0.39
175 0.27
176 0.18
177 0.11
178 0.09
179 0.08
180 0.05
181 0.04
182 0.04
183 0.05
184 0.09
185 0.14
186 0.15
187 0.17
188 0.18
189 0.18
190 0.2
191 0.24
192 0.22
193 0.19
194 0.23
195 0.22
196 0.24
197 0.27
198 0.26
199 0.22
200 0.21
201 0.21
202 0.18
203 0.2
204 0.19
205 0.17
206 0.18
207 0.16
208 0.15
209 0.15
210 0.13
211 0.09
212 0.07
213 0.06
214 0.05
215 0.05
216 0.06
217 0.06
218 0.07
219 0.08
220 0.08
221 0.1
222 0.11
223 0.11
224 0.12
225 0.15