Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7IGB8

Protein Details
Accession W7IGB8    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRSANGRNKKGRGHVKPIRCSNCSHydrophilic
94-124GKIVRVRSREGRRNRAPPPRVRYNKDGKKVTBasic
NLS Segment(s)
PositionSequence
3-18KKRSANGRNKKGRGHV
98-121RVRSREGRRNRAPPPRVRYNKDGK
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRSANGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDIIDASVFSDASSGYAYASNQSGYNIPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVRYNKDGKKVTPTQSGGKTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.8
4 0.78
5 0.77
6 0.8
7 0.84
8 0.81
9 0.73
10 0.72
11 0.7
12 0.7
13 0.69
14 0.67
15 0.64
16 0.65
17 0.69
18 0.7
19 0.72
20 0.71
21 0.73
22 0.74
23 0.76
24 0.72
25 0.73
26 0.69
27 0.69
28 0.61
29 0.53
30 0.47
31 0.38
32 0.35
33 0.28
34 0.25
35 0.15
36 0.14
37 0.12
38 0.1
39 0.09
40 0.07
41 0.07
42 0.05
43 0.04
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.09
61 0.09
62 0.12
63 0.12
64 0.12
65 0.13
66 0.15
67 0.17
68 0.21
69 0.21
70 0.22
71 0.25
72 0.26
73 0.25
74 0.26
75 0.24
76 0.2
77 0.21
78 0.19
79 0.2
80 0.2
81 0.22
82 0.23
83 0.29
84 0.32
85 0.33
86 0.36
87 0.41
88 0.5
89 0.56
90 0.62
91 0.66
92 0.7
93 0.76
94 0.81
95 0.82
96 0.8
97 0.81
98 0.8
99 0.81
100 0.81
101 0.79
102 0.79
103 0.79
104 0.81
105 0.81
106 0.8
107 0.72
108 0.72
109 0.73
110 0.71
111 0.69
112 0.63
113 0.61
114 0.61