Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7IGM6

Protein Details
Accession W7IGM6   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
97-123QHESSLKTEKQKKKEKHFPQRIYAIKAHydrophilic
NLS Segment(s)
PositionSequence
92-93RR
103-113KTEKQKKKEKH
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGVKTAQLWNKSKADLAKQLDELKTELAALRVQKIAGGASSKLTKIHDVRKSIARVMTVLNITQRHQLRLFYQKKKYIPLDLRPKQTRAIRRRLTQHESSLKTEKQKKKEKHFPQRIYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.45
4 0.45
5 0.43
6 0.43
7 0.47
8 0.44
9 0.4
10 0.35
11 0.27
12 0.21
13 0.18
14 0.15
15 0.11
16 0.12
17 0.12
18 0.13
19 0.13
20 0.13
21 0.13
22 0.12
23 0.11
24 0.1
25 0.11
26 0.09
27 0.1
28 0.12
29 0.12
30 0.13
31 0.14
32 0.18
33 0.2
34 0.29
35 0.32
36 0.34
37 0.37
38 0.41
39 0.42
40 0.4
41 0.37
42 0.28
43 0.24
44 0.21
45 0.2
46 0.14
47 0.13
48 0.13
49 0.12
50 0.13
51 0.18
52 0.18
53 0.19
54 0.19
55 0.2
56 0.21
57 0.31
58 0.39
59 0.41
60 0.47
61 0.51
62 0.53
63 0.58
64 0.57
65 0.56
66 0.54
67 0.55
68 0.59
69 0.59
70 0.67
71 0.64
72 0.63
73 0.61
74 0.61
75 0.62
76 0.59
77 0.64
78 0.62
79 0.65
80 0.72
81 0.74
82 0.74
83 0.7
84 0.7
85 0.68
86 0.65
87 0.63
88 0.61
89 0.56
90 0.59
91 0.64
92 0.64
93 0.65
94 0.71
95 0.76
96 0.8
97 0.87
98 0.89
99 0.9
100 0.92
101 0.9
102 0.88
103 0.88