Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7I4C1

Protein Details
Accession W7I4C1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-33VGGIIYFRNRKKRKEEERARQEWYAHydrophilic
NLS Segment(s)
PositionSequence
18-22RKKRK
Subcellular Location(s) extr 13, nucl 7, mito 5
Family & Domain DBs
Amino Acid Sequences MVVELILIVGGIIYFRNRKKRKEEERARQEWYASGHPPSSSPSPAPHQYSRPTSPAPGHKPPAPYANTAPPGAPFIPPPQQQFGPSPAYNPGDYPSYAPPAYGTLQSQGAASGYAGQSRQQDVKNAGSASRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.2
3 0.31
4 0.38
5 0.46
6 0.56
7 0.67
8 0.75
9 0.8
10 0.85
11 0.86
12 0.9
13 0.88
14 0.83
15 0.73
16 0.63
17 0.54
18 0.47
19 0.4
20 0.32
21 0.28
22 0.24
23 0.22
24 0.22
25 0.23
26 0.22
27 0.2
28 0.19
29 0.21
30 0.25
31 0.3
32 0.35
33 0.34
34 0.35
35 0.38
36 0.43
37 0.43
38 0.41
39 0.37
40 0.34
41 0.36
42 0.4
43 0.41
44 0.41
45 0.41
46 0.4
47 0.42
48 0.41
49 0.42
50 0.36
51 0.31
52 0.28
53 0.29
54 0.29
55 0.26
56 0.25
57 0.19
58 0.19
59 0.17
60 0.15
61 0.11
62 0.12
63 0.19
64 0.21
65 0.23
66 0.25
67 0.25
68 0.27
69 0.28
70 0.28
71 0.28
72 0.25
73 0.24
74 0.25
75 0.26
76 0.24
77 0.22
78 0.21
79 0.17
80 0.17
81 0.18
82 0.16
83 0.19
84 0.18
85 0.18
86 0.16
87 0.17
88 0.18
89 0.17
90 0.16
91 0.14
92 0.15
93 0.15
94 0.14
95 0.12
96 0.11
97 0.09
98 0.08
99 0.09
100 0.09
101 0.11
102 0.11
103 0.14
104 0.17
105 0.2
106 0.26
107 0.25
108 0.31
109 0.33
110 0.37
111 0.4
112 0.38