Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7HPR8

Protein Details
Accession W7HPR8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-78LELERLKKQRLQRRKERLDAAGHydrophilic
NLS Segment(s)
PositionSequence
62-82LKKQRLQRRKERLDAAGSRER
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGGLNLEVFKFGIYILFPIASMYYFGTNLDSRFSVPDFWPSKEETHRIPFEKEEIRLELERLKKQRLQRRKERLDAAGSRERRERLVESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.08
7 0.07
8 0.07
9 0.08
10 0.08
11 0.08
12 0.08
13 0.1
14 0.11
15 0.11
16 0.12
17 0.12
18 0.11
19 0.13
20 0.13
21 0.13
22 0.12
23 0.2
24 0.21
25 0.22
26 0.23
27 0.24
28 0.26
29 0.27
30 0.29
31 0.24
32 0.27
33 0.3
34 0.3
35 0.3
36 0.27
37 0.29
38 0.3
39 0.28
40 0.24
41 0.22
42 0.23
43 0.22
44 0.22
45 0.23
46 0.26
47 0.31
48 0.32
49 0.36
50 0.38
51 0.46
52 0.55
53 0.6
54 0.65
55 0.69
56 0.77
57 0.81
58 0.84
59 0.81
60 0.76
61 0.74
62 0.69
63 0.66
64 0.64
65 0.57
66 0.53
67 0.53
68 0.5
69 0.43
70 0.44