Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QKV8

Protein Details
Accession B6QKV8    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
63-82LLVNAKKEKMKEKRPEFKKKBasic
NLS Segment(s)
PositionSequence
7-42KKAKPTTAKKSSKLGPRVITPKKVALAKQRKSMKKL
67-82AKKEKMKEKRPEFKKK
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG tmf:PMAA_055320  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQAPLKKAKPTTAKKSSKLGPRVITPKKVALAKQRKSMKKLSSGLINKTERSLAERAGHLELLVNAKKEKMKEKRPEFKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.7
3 0.76
4 0.74
5 0.73
6 0.7
7 0.67
8 0.59
9 0.58
10 0.64
11 0.62
12 0.6
13 0.53
14 0.49
15 0.47
16 0.46
17 0.43
18 0.44
19 0.48
20 0.48
21 0.54
22 0.6
23 0.6
24 0.61
25 0.65
26 0.58
27 0.56
28 0.54
29 0.47
30 0.47
31 0.46
32 0.45
33 0.45
34 0.43
35 0.35
36 0.33
37 0.32
38 0.23
39 0.24
40 0.22
41 0.18
42 0.19
43 0.19
44 0.21
45 0.21
46 0.21
47 0.16
48 0.16
49 0.14
50 0.17
51 0.18
52 0.17
53 0.16
54 0.19
55 0.23
56 0.26
57 0.35
58 0.4
59 0.48
60 0.58
61 0.68
62 0.76