Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059J8Q1

Protein Details
Accession A0A059J8Q1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-35GEYWEENKAYKKRKLERRKNNPPKQRCFDWMHydrophilic
NLS Segment(s)
PositionSequence
15-27KKRKLERRKNNPP
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MGEIGEYWEENKAYKKRKLERRKNNPPKQRCFDWMITSGISYAKNRSSFKTYRHIRPVTLSSGTGARVIGVGSVELKVPRSPDNPEVNTLILDDVLHIPGAICNGFSPQLLGGSTSFGDPLQGYDDDKQPSYYATTFCGLWRLVLNGNPEGETQLAEARRNGSKLSLSVYINEEDEEHIFGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.61
4 0.72
5 0.82
6 0.84
7 0.87
8 0.9
9 0.94
10 0.95
11 0.96
12 0.96
13 0.94
14 0.93
15 0.9
16 0.84
17 0.78
18 0.74
19 0.68
20 0.63
21 0.55
22 0.47
23 0.4
24 0.34
25 0.29
26 0.23
27 0.2
28 0.16
29 0.16
30 0.19
31 0.25
32 0.26
33 0.3
34 0.36
35 0.38
36 0.42
37 0.49
38 0.51
39 0.55
40 0.62
41 0.6
42 0.54
43 0.55
44 0.53
45 0.47
46 0.41
47 0.32
48 0.24
49 0.23
50 0.22
51 0.17
52 0.13
53 0.09
54 0.07
55 0.07
56 0.06
57 0.05
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.07
64 0.07
65 0.09
66 0.12
67 0.13
68 0.17
69 0.23
70 0.3
71 0.3
72 0.31
73 0.3
74 0.28
75 0.26
76 0.22
77 0.15
78 0.08
79 0.07
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.04
89 0.04
90 0.04
91 0.05
92 0.06
93 0.05
94 0.06
95 0.05
96 0.06
97 0.06
98 0.07
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.07
106 0.06
107 0.06
108 0.08
109 0.08
110 0.1
111 0.12
112 0.16
113 0.18
114 0.18
115 0.18
116 0.16
117 0.16
118 0.18
119 0.18
120 0.14
121 0.15
122 0.16
123 0.16
124 0.16
125 0.18
126 0.15
127 0.14
128 0.14
129 0.14
130 0.15
131 0.18
132 0.21
133 0.19
134 0.2
135 0.2
136 0.19
137 0.18
138 0.16
139 0.13
140 0.11
141 0.14
142 0.15
143 0.16
144 0.17
145 0.2
146 0.23
147 0.24
148 0.24
149 0.22
150 0.23
151 0.23
152 0.26
153 0.27
154 0.24
155 0.26
156 0.28
157 0.26
158 0.24
159 0.23
160 0.2
161 0.16
162 0.17