Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059JHC6

Protein Details
Accession A0A059JHC6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
205-230GVDPSKAPPTRKKRKIPRSGRPAALKBasic
NLS Segment(s)
PositionSequence
210-228KAPPTRKKRKIPRSGRPAA
Subcellular Location(s) plas 19, E.R. 3, vacu 2, mito 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004299  MBOAT_fam  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03062  MBOAT  
Amino Acid Sequences MLPYINAPFAAAGEVIGASADELKLITSFLLSYPLAAILKRLPDSQPWKKNAFIIAVSLFYLVGLFDLWDGVRTLLYCSAGAYAIAYYVDGSMMPWVGFTYLIGYMSVSHIIRQIVNDPTSVDVTGAQMVLVMKLSAFCWNVHDGRLPDNQLSEAQKHAAIKEFPSLLDFAGYVLFFPSLFAGPAFDYVEYRRWIETSMFDLPPGVDPSKAPPTRKKRKIPRSGRPAALKAAMGLAFIGAFIVFAPIYTTNLLLSEEFAAYSFFRKIWVLYVFGFAARLKYYGVWSLTEGACILSGMGYNGVDRNTGQVYWNKLENVNAYGLETAQNPHAFLANWNKNTNHWLRNYIYLRVTPKGKKPGFRASLATFATSAIWHGFYPGYYLTFILGSFVQTSAKHFRRHVRPFFLTPDGTAPTGFKIYYDIISWLATQLTMSFTIAPFILLDFTDCTTLWGRVYFYIIIGIVATLTFFNSPAKAQLIRKLNKRNKVATGKGAEIPGKPSDRQAANEAAAVRAREKAQADAREVQAGQTPYTEQPLGLPNDLAQDVEDAVNEIKKEIETRRRRGSVVSMPTGAELRNILEQKLGKAPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.05
5 0.04
6 0.06
7 0.06
8 0.05
9 0.05
10 0.06
11 0.06
12 0.07
13 0.07
14 0.06
15 0.07
16 0.07
17 0.11
18 0.11
19 0.11
20 0.11
21 0.14
22 0.14
23 0.14
24 0.15
25 0.15
26 0.2
27 0.22
28 0.24
29 0.23
30 0.32
31 0.42
32 0.51
33 0.56
34 0.58
35 0.59
36 0.59
37 0.61
38 0.56
39 0.51
40 0.41
41 0.35
42 0.3
43 0.27
44 0.25
45 0.21
46 0.16
47 0.12
48 0.11
49 0.06
50 0.05
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.07
58 0.07
59 0.08
60 0.08
61 0.1
62 0.12
63 0.13
64 0.12
65 0.12
66 0.12
67 0.12
68 0.11
69 0.1
70 0.07
71 0.07
72 0.07
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.07
88 0.07
89 0.08
90 0.08
91 0.08
92 0.08
93 0.1
94 0.13
95 0.11
96 0.11
97 0.13
98 0.14
99 0.15
100 0.16
101 0.19
102 0.21
103 0.21
104 0.21
105 0.19
106 0.2
107 0.2
108 0.19
109 0.15
110 0.1
111 0.1
112 0.1
113 0.1
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.06
120 0.05
121 0.06
122 0.07
123 0.09
124 0.11
125 0.11
126 0.13
127 0.18
128 0.19
129 0.2
130 0.24
131 0.21
132 0.25
133 0.29
134 0.28
135 0.25
136 0.24
137 0.24
138 0.23
139 0.25
140 0.22
141 0.19
142 0.18
143 0.2
144 0.2
145 0.2
146 0.21
147 0.19
148 0.19
149 0.22
150 0.21
151 0.19
152 0.19
153 0.18
154 0.13
155 0.12
156 0.11
157 0.07
158 0.07
159 0.07
160 0.06
161 0.06
162 0.06
163 0.05
164 0.05
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.08
172 0.09
173 0.08
174 0.09
175 0.1
176 0.15
177 0.15
178 0.16
179 0.15
180 0.15
181 0.17
182 0.17
183 0.17
184 0.17
185 0.21
186 0.19
187 0.19
188 0.19
189 0.17
190 0.18
191 0.19
192 0.15
193 0.11
194 0.11
195 0.16
196 0.26
197 0.29
198 0.31
199 0.38
200 0.48
201 0.59
202 0.68
203 0.74
204 0.75
205 0.83
206 0.9
207 0.91
208 0.91
209 0.9
210 0.87
211 0.83
212 0.77
213 0.69
214 0.6
215 0.51
216 0.4
217 0.3
218 0.24
219 0.17
220 0.12
221 0.09
222 0.07
223 0.05
224 0.04
225 0.04
226 0.02
227 0.02
228 0.02
229 0.03
230 0.03
231 0.03
232 0.04
233 0.05
234 0.06
235 0.06
236 0.06
237 0.06
238 0.07
239 0.07
240 0.06
241 0.06
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.08
249 0.08
250 0.06
251 0.08
252 0.08
253 0.08
254 0.11
255 0.12
256 0.13
257 0.12
258 0.14
259 0.13
260 0.13
261 0.13
262 0.09
263 0.09
264 0.08
265 0.08
266 0.06
267 0.07
268 0.08
269 0.1
270 0.11
271 0.1
272 0.1
273 0.13
274 0.12
275 0.12
276 0.11
277 0.08
278 0.07
279 0.07
280 0.06
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.05
288 0.05
289 0.05
290 0.05
291 0.07
292 0.07
293 0.07
294 0.09
295 0.11
296 0.15
297 0.17
298 0.18
299 0.17
300 0.17
301 0.18
302 0.18
303 0.16
304 0.13
305 0.11
306 0.1
307 0.09
308 0.09
309 0.09
310 0.08
311 0.07
312 0.09
313 0.09
314 0.09
315 0.09
316 0.1
317 0.09
318 0.11
319 0.21
320 0.25
321 0.27
322 0.29
323 0.3
324 0.3
325 0.35
326 0.38
327 0.33
328 0.29
329 0.31
330 0.3
331 0.39
332 0.4
333 0.37
334 0.33
335 0.32
336 0.33
337 0.31
338 0.36
339 0.32
340 0.37
341 0.44
342 0.46
343 0.48
344 0.51
345 0.58
346 0.56
347 0.54
348 0.52
349 0.43
350 0.46
351 0.4
352 0.35
353 0.25
354 0.21
355 0.18
356 0.14
357 0.12
358 0.07
359 0.07
360 0.06
361 0.07
362 0.07
363 0.07
364 0.09
365 0.08
366 0.09
367 0.08
368 0.08
369 0.08
370 0.08
371 0.08
372 0.07
373 0.07
374 0.06
375 0.07
376 0.07
377 0.08
378 0.08
379 0.12
380 0.21
381 0.26
382 0.29
383 0.33
384 0.42
385 0.51
386 0.61
387 0.65
388 0.65
389 0.65
390 0.64
391 0.65
392 0.6
393 0.5
394 0.4
395 0.35
396 0.28
397 0.24
398 0.21
399 0.16
400 0.13
401 0.14
402 0.13
403 0.1
404 0.1
405 0.11
406 0.12
407 0.12
408 0.12
409 0.12
410 0.12
411 0.12
412 0.1
413 0.09
414 0.08
415 0.07
416 0.06
417 0.07
418 0.07
419 0.07
420 0.08
421 0.07
422 0.09
423 0.09
424 0.08
425 0.07
426 0.06
427 0.07
428 0.06
429 0.07
430 0.07
431 0.08
432 0.09
433 0.09
434 0.11
435 0.12
436 0.13
437 0.13
438 0.13
439 0.14
440 0.13
441 0.16
442 0.14
443 0.12
444 0.12
445 0.11
446 0.1
447 0.09
448 0.08
449 0.05
450 0.05
451 0.05
452 0.04
453 0.04
454 0.05
455 0.05
456 0.07
457 0.08
458 0.08
459 0.11
460 0.14
461 0.18
462 0.21
463 0.28
464 0.37
465 0.43
466 0.52
467 0.61
468 0.66
469 0.7
470 0.75
471 0.74
472 0.74
473 0.76
474 0.72
475 0.7
476 0.66
477 0.6
478 0.55
479 0.52
480 0.45
481 0.37
482 0.35
483 0.32
484 0.31
485 0.28
486 0.29
487 0.33
488 0.33
489 0.35
490 0.36
491 0.35
492 0.32
493 0.35
494 0.32
495 0.26
496 0.25
497 0.23
498 0.2
499 0.19
500 0.19
501 0.21
502 0.22
503 0.27
504 0.33
505 0.37
506 0.41
507 0.43
508 0.43
509 0.42
510 0.41
511 0.35
512 0.33
513 0.29
514 0.24
515 0.2
516 0.21
517 0.19
518 0.23
519 0.22
520 0.16
521 0.18
522 0.24
523 0.26
524 0.25
525 0.24
526 0.2
527 0.23
528 0.23
529 0.21
530 0.14
531 0.12
532 0.12
533 0.12
534 0.11
535 0.09
536 0.1
537 0.13
538 0.12
539 0.12
540 0.12
541 0.13
542 0.18
543 0.26
544 0.35
545 0.43
546 0.52
547 0.62
548 0.65
549 0.65
550 0.64
551 0.64
552 0.63
553 0.62
554 0.58
555 0.49
556 0.45
557 0.45
558 0.42
559 0.33
560 0.25
561 0.17
562 0.15
563 0.21
564 0.22
565 0.21
566 0.25
567 0.27
568 0.29