Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059J5S5

Protein Details
Accession A0A059J5S5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MESRDIWEKKNRQRQRCHIALNKLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 12, cyto 8.5, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MESRDIWEKKNRQRQRCHIALNKLFSHFLVFGEYYVVGCGAVWYGEKRGLRSAGGLPCHPLLSPERASLGQSGLSTGGLAKDGRAASADDDGLGMREDGGDCEAAGALDVHEEGSGSRHKGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.86
4 0.85
5 0.82
6 0.83
7 0.79
8 0.74
9 0.66
10 0.59
11 0.51
12 0.42
13 0.36
14 0.26
15 0.2
16 0.17
17 0.15
18 0.12
19 0.13
20 0.13
21 0.09
22 0.09
23 0.09
24 0.05
25 0.05
26 0.05
27 0.03
28 0.04
29 0.04
30 0.05
31 0.06
32 0.11
33 0.12
34 0.13
35 0.16
36 0.16
37 0.16
38 0.17
39 0.21
40 0.2
41 0.21
42 0.2
43 0.19
44 0.18
45 0.18
46 0.16
47 0.13
48 0.11
49 0.14
50 0.15
51 0.14
52 0.15
53 0.15
54 0.16
55 0.15
56 0.14
57 0.1
58 0.09
59 0.09
60 0.07
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.06
67 0.05
68 0.08
69 0.08
70 0.09
71 0.1
72 0.1
73 0.1
74 0.11
75 0.11
76 0.08
77 0.08
78 0.08
79 0.08
80 0.07
81 0.06
82 0.05
83 0.05
84 0.06
85 0.06
86 0.07
87 0.07
88 0.06
89 0.07
90 0.07
91 0.06
92 0.06
93 0.05
94 0.04
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.08
102 0.12