Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059JHJ1

Protein Details
Accession A0A059JHJ1   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-43QNGRNVLCRIRQKKRGKTTSKAEKSQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 14, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MVYNLTSIKRMIIFCKRQNGRNVLCRIRQKKRGKTTSKAEKSQDIYGGQVPVPKTDMTWTRKGDAMPWEKNKSAALSTSAFEIPPTTNHQPNRTISYPVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.56
3 0.58
4 0.61
5 0.68
6 0.69
7 0.66
8 0.66
9 0.67
10 0.63
11 0.66
12 0.7
13 0.71
14 0.71
15 0.75
16 0.76
17 0.78
18 0.83
19 0.86
20 0.83
21 0.82
22 0.83
23 0.84
24 0.82
25 0.78
26 0.69
27 0.64
28 0.6
29 0.54
30 0.46
31 0.35
32 0.29
33 0.24
34 0.22
35 0.16
36 0.15
37 0.13
38 0.11
39 0.12
40 0.1
41 0.09
42 0.12
43 0.19
44 0.21
45 0.28
46 0.29
47 0.29
48 0.32
49 0.32
50 0.32
51 0.33
52 0.36
53 0.37
54 0.42
55 0.45
56 0.43
57 0.45
58 0.42
59 0.36
60 0.29
61 0.23
62 0.2
63 0.17
64 0.17
65 0.19
66 0.18
67 0.16
68 0.15
69 0.15
70 0.12
71 0.13
72 0.21
73 0.24
74 0.31
75 0.36
76 0.41
77 0.45
78 0.49
79 0.54
80 0.49