Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059J1M7

Protein Details
Accession A0A059J1M7   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-47IKGSKVQDGRVDKKKKKKKRDKEGDVAVRGEBasic
NLS Segment(s)
PositionSequence
14-38RLKIKGSKVQDGRVDKKKKKKKRDK
90-112RRHAEAKRKRLNERLKREGVKTH
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPSSEYAVSGGGRLKIKGSKVQDGRVDKKKKKKKRDKEGDVAVRGEEEEESKADAAVGEASSSKEEKDRRSRSVSELLEGDDGKTEAERRHAEAKRKRLNERLKREGVKTHKERVEELNKYLSNLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.23
4 0.27
5 0.33
6 0.36
7 0.41
8 0.44
9 0.5
10 0.54
11 0.59
12 0.63
13 0.66
14 0.71
15 0.69
16 0.76
17 0.8
18 0.83
19 0.86
20 0.89
21 0.9
22 0.91
23 0.95
24 0.93
25 0.92
26 0.92
27 0.89
28 0.81
29 0.7
30 0.58
31 0.47
32 0.37
33 0.27
34 0.17
35 0.1
36 0.07
37 0.07
38 0.08
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.05
45 0.05
46 0.04
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.1
53 0.14
54 0.2
55 0.3
56 0.35
57 0.39
58 0.44
59 0.46
60 0.45
61 0.51
62 0.45
63 0.36
64 0.31
65 0.28
66 0.23
67 0.21
68 0.17
69 0.09
70 0.09
71 0.07
72 0.07
73 0.08
74 0.08
75 0.14
76 0.15
77 0.18
78 0.27
79 0.32
80 0.42
81 0.49
82 0.58
83 0.62
84 0.68
85 0.7
86 0.71
87 0.77
88 0.77
89 0.79
90 0.78
91 0.77
92 0.74
93 0.71
94 0.71
95 0.68
96 0.69
97 0.65
98 0.65
99 0.6
100 0.58
101 0.58
102 0.58
103 0.59
104 0.53
105 0.5
106 0.49
107 0.45
108 0.45
109 0.43
110 0.35
111 0.28
112 0.25
113 0.27
114 0.23
115 0.24
116 0.25
117 0.3
118 0.28