Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059IZ01

Protein Details
Accession A0A059IZ01   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-44RLKAEKPDRYKPKQWEEARRRGPSBasic
NLS Segment(s)
PositionSequence
29-33RYKPK
Subcellular Location(s) nucl 13, cyto_nucl 10.5, cyto 6, pero 3, mito 2
Family & Domain DBs
Amino Acid Sequences MDLDPVEYPVNSPQWRREITRLKAEKPDRYKPKQWEEARRRGPSEWRWEAPVLLRGLFDTPEKIQEHAGLSEVPKVQSAQTVPDSLIHPADKLETVQYCMVDGNGYCRLRERYQNIKLTTLLIDGENRASHIFYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.46
4 0.52
5 0.55
6 0.57
7 0.65
8 0.65
9 0.62
10 0.68
11 0.7
12 0.69
13 0.67
14 0.71
15 0.7
16 0.73
17 0.77
18 0.76
19 0.79
20 0.8
21 0.8
22 0.81
23 0.8
24 0.83
25 0.83
26 0.78
27 0.72
28 0.64
29 0.64
30 0.6
31 0.6
32 0.56
33 0.48
34 0.46
35 0.44
36 0.42
37 0.35
38 0.33
39 0.24
40 0.18
41 0.16
42 0.13
43 0.14
44 0.13
45 0.12
46 0.09
47 0.09
48 0.13
49 0.14
50 0.14
51 0.14
52 0.15
53 0.15
54 0.13
55 0.14
56 0.1
57 0.09
58 0.12
59 0.12
60 0.1
61 0.1
62 0.1
63 0.09
64 0.11
65 0.11
66 0.12
67 0.12
68 0.13
69 0.13
70 0.15
71 0.15
72 0.14
73 0.15
74 0.12
75 0.11
76 0.1
77 0.11
78 0.09
79 0.09
80 0.11
81 0.1
82 0.13
83 0.14
84 0.13
85 0.13
86 0.13
87 0.12
88 0.1
89 0.09
90 0.11
91 0.17
92 0.18
93 0.18
94 0.22
95 0.27
96 0.31
97 0.39
98 0.43
99 0.45
100 0.54
101 0.62
102 0.6
103 0.57
104 0.54
105 0.47
106 0.41
107 0.31
108 0.24
109 0.17
110 0.16
111 0.14
112 0.16
113 0.15
114 0.15
115 0.15