Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QN95

Protein Details
Accession B6QN95    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
297-320DAEVCRTRLRIKFRRKQWDVIRSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5, mito 8, cyto_nucl 7.5, cyto 5.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022698  OrsD  
KEGG tmf:PMAA_061780  -  
Pfam View protein in Pfam  
PF12013  OrsD  
Amino Acid Sequences MTATPAVLPQWRDLPVYWDWNFRLLICESCGFALGPNQASSHFWEKHQVSIEQRHGLTEYLRQHDFQEPASVAPRPRGAPEHPALRTYNGLACRLCETIFDISIPTGLGPRVGRWINFMTTCTCRRGTVNHIGLSVAAVERERTRHAAIQAATVQDSGIATRSFESLRPWIERTGWEQTYDGLHRDLLRRLTEMPLLYNSCQDHRLWSSPEEADLVSPAADKRVIWRIAYAVDSMLDRCEETMRHTGRPILCWLRTLQLSPYYPKPFVFLARSASTSRYRRIWKRFIVFLFRCFRLDAEVCRTRLRIKFRRKQWDVIRSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.35
4 0.34
5 0.36
6 0.35
7 0.36
8 0.36
9 0.32
10 0.31
11 0.25
12 0.25
13 0.22
14 0.22
15 0.19
16 0.19
17 0.19
18 0.15
19 0.14
20 0.16
21 0.17
22 0.18
23 0.18
24 0.18
25 0.18
26 0.19
27 0.24
28 0.28
29 0.26
30 0.25
31 0.34
32 0.34
33 0.38
34 0.41
35 0.4
36 0.39
37 0.46
38 0.5
39 0.47
40 0.46
41 0.41
42 0.38
43 0.35
44 0.3
45 0.28
46 0.28
47 0.28
48 0.29
49 0.28
50 0.3
51 0.35
52 0.35
53 0.29
54 0.28
55 0.23
56 0.23
57 0.25
58 0.26
59 0.21
60 0.23
61 0.25
62 0.21
63 0.23
64 0.27
65 0.27
66 0.32
67 0.36
68 0.4
69 0.38
70 0.39
71 0.38
72 0.35
73 0.33
74 0.27
75 0.27
76 0.21
77 0.23
78 0.2
79 0.2
80 0.2
81 0.2
82 0.18
83 0.14
84 0.15
85 0.14
86 0.14
87 0.13
88 0.11
89 0.1
90 0.1
91 0.1
92 0.07
93 0.06
94 0.06
95 0.08
96 0.08
97 0.08
98 0.14
99 0.15
100 0.15
101 0.18
102 0.2
103 0.2
104 0.2
105 0.21
106 0.19
107 0.22
108 0.24
109 0.24
110 0.23
111 0.21
112 0.22
113 0.25
114 0.28
115 0.33
116 0.36
117 0.34
118 0.33
119 0.32
120 0.3
121 0.27
122 0.2
123 0.1
124 0.06
125 0.04
126 0.05
127 0.06
128 0.08
129 0.09
130 0.11
131 0.13
132 0.16
133 0.17
134 0.2
135 0.2
136 0.21
137 0.21
138 0.19
139 0.17
140 0.14
141 0.13
142 0.08
143 0.08
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.07
150 0.07
151 0.08
152 0.1
153 0.11
154 0.14
155 0.16
156 0.17
157 0.17
158 0.18
159 0.19
160 0.21
161 0.25
162 0.23
163 0.22
164 0.21
165 0.2
166 0.22
167 0.21
168 0.18
169 0.12
170 0.12
171 0.13
172 0.15
173 0.17
174 0.18
175 0.18
176 0.18
177 0.19
178 0.19
179 0.2
180 0.18
181 0.16
182 0.16
183 0.17
184 0.16
185 0.18
186 0.17
187 0.16
188 0.18
189 0.16
190 0.18
191 0.19
192 0.22
193 0.22
194 0.22
195 0.24
196 0.23
197 0.23
198 0.2
199 0.17
200 0.13
201 0.11
202 0.1
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.1
210 0.18
211 0.19
212 0.19
213 0.2
214 0.2
215 0.21
216 0.22
217 0.19
218 0.11
219 0.1
220 0.1
221 0.1
222 0.09
223 0.08
224 0.07
225 0.07
226 0.09
227 0.09
228 0.13
229 0.22
230 0.24
231 0.25
232 0.27
233 0.32
234 0.32
235 0.34
236 0.37
237 0.35
238 0.32
239 0.32
240 0.33
241 0.31
242 0.31
243 0.3
244 0.26
245 0.27
246 0.29
247 0.31
248 0.38
249 0.38
250 0.39
251 0.37
252 0.37
253 0.31
254 0.34
255 0.34
256 0.29
257 0.3
258 0.31
259 0.33
260 0.32
261 0.34
262 0.37
263 0.38
264 0.4
265 0.42
266 0.49
267 0.57
268 0.65
269 0.7
270 0.71
271 0.73
272 0.76
273 0.74
274 0.74
275 0.68
276 0.66
277 0.63
278 0.56
279 0.5
280 0.43
281 0.38
282 0.35
283 0.35
284 0.33
285 0.36
286 0.4
287 0.41
288 0.44
289 0.45
290 0.45
291 0.49
292 0.54
293 0.55
294 0.59
295 0.67
296 0.74
297 0.84
298 0.82
299 0.86
300 0.86