Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059J608

Protein Details
Accession A0A059J608   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
93-118EDWYWAMRRRQKKQREKERRKLETEABasic
NLS Segment(s)
PositionSequence
100-113RRRQKKQREKERRK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences YKCCALEKDVDWVACEDRPPGMNCPKAQEHNWQGPYAQYVGEIEGPCWNCMWASYNDGGKAKREFIENFGKRKPGEQPWESDEERKDQRMAGEDWYWAMRRRQKKQREKERRKLETEAGRVTHSTVQWPEGVEGEGTSGSSTPGTSGSRPDSLPGSQHASRPSSRYAFSVAGAQTPSRQLPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.18
4 0.16
5 0.2
6 0.21
7 0.27
8 0.33
9 0.37
10 0.38
11 0.44
12 0.47
13 0.49
14 0.49
15 0.52
16 0.51
17 0.55
18 0.56
19 0.5
20 0.43
21 0.39
22 0.38
23 0.29
24 0.21
25 0.12
26 0.1
27 0.11
28 0.15
29 0.13
30 0.12
31 0.16
32 0.17
33 0.17
34 0.17
35 0.15
36 0.11
37 0.12
38 0.16
39 0.12
40 0.15
41 0.17
42 0.19
43 0.21
44 0.24
45 0.24
46 0.23
47 0.24
48 0.22
49 0.21
50 0.23
51 0.21
52 0.24
53 0.34
54 0.35
55 0.38
56 0.38
57 0.4
58 0.36
59 0.38
60 0.39
61 0.36
62 0.4
63 0.37
64 0.39
65 0.38
66 0.44
67 0.42
68 0.39
69 0.32
70 0.3
71 0.3
72 0.28
73 0.25
74 0.2
75 0.2
76 0.2
77 0.2
78 0.17
79 0.16
80 0.14
81 0.14
82 0.15
83 0.15
84 0.13
85 0.17
86 0.22
87 0.3
88 0.4
89 0.49
90 0.59
91 0.69
92 0.78
93 0.84
94 0.89
95 0.91
96 0.92
97 0.93
98 0.9
99 0.84
100 0.77
101 0.73
102 0.7
103 0.64
104 0.57
105 0.47
106 0.41
107 0.36
108 0.33
109 0.29
110 0.21
111 0.2
112 0.17
113 0.17
114 0.17
115 0.17
116 0.16
117 0.14
118 0.14
119 0.1
120 0.09
121 0.08
122 0.07
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.08
131 0.1
132 0.11
133 0.15
134 0.18
135 0.21
136 0.21
137 0.22
138 0.23
139 0.22
140 0.24
141 0.23
142 0.26
143 0.26
144 0.29
145 0.32
146 0.33
147 0.35
148 0.36
149 0.39
150 0.36
151 0.35
152 0.34
153 0.34
154 0.31
155 0.29
156 0.31
157 0.25
158 0.24
159 0.24
160 0.23
161 0.21
162 0.23