Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059JJ36

Protein Details
Accession A0A059JJ36    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-39VLLSVAGSREKKRKKRKKRRKKKKCCLKEDRTRSTVTBasic
NLS Segment(s)
PositionSequence
11-26REKKRKKRKKRRKKKK
Subcellular Location(s) mito 20, mito_nucl 13.833, cyto_mito 10.833, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MLVLLSVAGSREKKRKKRKKRRKKKKCCLKEDRTRSTVTGLCAAPSILPLLTTFAPSGPGGNTGIQPPFLPPEDCPSEYIRHADSDAASYAMGQYLYPRTLQERPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.73
3 0.8
4 0.88
5 0.94
6 0.95
7 0.97
8 0.98
9 0.98
10 0.98
11 0.98
12 0.98
13 0.97
14 0.97
15 0.96
16 0.95
17 0.95
18 0.93
19 0.9
20 0.82
21 0.73
22 0.62
23 0.55
24 0.47
25 0.37
26 0.31
27 0.23
28 0.2
29 0.18
30 0.17
31 0.13
32 0.1
33 0.09
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.07
41 0.06
42 0.08
43 0.08
44 0.08
45 0.06
46 0.07
47 0.08
48 0.09
49 0.09
50 0.09
51 0.1
52 0.1
53 0.1
54 0.09
55 0.11
56 0.12
57 0.12
58 0.11
59 0.17
60 0.22
61 0.23
62 0.24
63 0.25
64 0.26
65 0.26
66 0.29
67 0.23
68 0.19
69 0.19
70 0.19
71 0.16
72 0.15
73 0.15
74 0.12
75 0.11
76 0.1
77 0.09
78 0.09
79 0.09
80 0.06
81 0.09
82 0.12
83 0.13
84 0.14
85 0.15
86 0.2
87 0.24