Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059JHM5

Protein Details
Accession A0A059JHM5    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
3-34REIEKVKKEYEEKQRKKREKEKEKDKEKDGEKBasic
91-113DRLKAIEKSKRDRQRLQNPSTFPHydrophilic
NLS Segment(s)
PositionSequence
10-49KEYEEKQRKKREKEKEKDKEKDGEKADDKKKAEEEEESKK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MDREIEKVKKEYEEKQRKKREKEKEKDKEKDGEKADDKKKAEEEEESKKDEKEKDDKIKSIQNAAGPVDASTDDMPRIYSLHKNFYQMRVDRLKAIEKSKRDRQRLQNPSTFPSVPKTDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.74
3 0.82
4 0.84
5 0.9
6 0.91
7 0.91
8 0.91
9 0.92
10 0.92
11 0.92
12 0.92
13 0.9
14 0.85
15 0.83
16 0.75
17 0.72
18 0.64
19 0.62
20 0.58
21 0.59
22 0.59
23 0.57
24 0.55
25 0.5
26 0.5
27 0.44
28 0.39
29 0.36
30 0.36
31 0.38
32 0.39
33 0.4
34 0.38
35 0.36
36 0.38
37 0.36
38 0.36
39 0.34
40 0.39
41 0.45
42 0.48
43 0.49
44 0.48
45 0.5
46 0.45
47 0.41
48 0.34
49 0.26
50 0.23
51 0.22
52 0.19
53 0.14
54 0.13
55 0.1
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.15
67 0.17
68 0.24
69 0.26
70 0.31
71 0.33
72 0.37
73 0.43
74 0.38
75 0.42
76 0.41
77 0.41
78 0.4
79 0.4
80 0.42
81 0.39
82 0.45
83 0.46
84 0.48
85 0.55
86 0.62
87 0.69
88 0.71
89 0.76
90 0.78
91 0.82
92 0.84
93 0.84
94 0.82
95 0.76
96 0.71
97 0.68
98 0.58
99 0.49
100 0.46
101 0.42