Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059JIX2

Protein Details
Accession A0A059JIX2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
374-393EEKGEKADKEERPRKKAKKABasic
NLS Segment(s)
PositionSequence
377-393GEKADKEERPRKKAKKA
Subcellular Location(s) cyto 15.5, cyto_nucl 12.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037231  NAP-like_sf  
IPR002164  NAP_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00956  NAP  
Amino Acid Sequences MADAGDDQVPLLERVEMPSKLPKELQREMTLLQDEFADAQVEHMRVGVNLMRPVYAKRNELIASKLKDLDFWPRVFSNLPAEIDEFILPSDAQILASCLKNFNIERIGVDEATGQGEPRSLRFTFEFDTGDDNIWFTNDKLVKDFHWRRELKITAAGKRRVWEGLVSEPVRINWKPDMDPTHGLLDAACDLAEAEKAFIKKEKKDKISEDERMSLPEFEKLVELAAKVEAQAAPDNEGEEDGDEDGASPAGLSFFAWFGYRGADVSEKESEAARKEDKETTEKRRKGEDIPGEDDDEDDEDEEEEDSLAIAEIFADGQNVAIAFGEEVWPEALQSYVDSYMVPDDFEDFDELDVEEMEALVAGGADDDDDDKEEEKGEKADKEERPRKKAKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.21
3 0.2
4 0.22
5 0.3
6 0.32
7 0.34
8 0.39
9 0.42
10 0.45
11 0.52
12 0.56
13 0.52
14 0.52
15 0.5
16 0.5
17 0.46
18 0.38
19 0.3
20 0.23
21 0.19
22 0.17
23 0.16
24 0.12
25 0.08
26 0.1
27 0.14
28 0.14
29 0.13
30 0.13
31 0.13
32 0.12
33 0.15
34 0.16
35 0.16
36 0.19
37 0.19
38 0.2
39 0.2
40 0.24
41 0.3
42 0.32
43 0.31
44 0.29
45 0.34
46 0.35
47 0.36
48 0.38
49 0.37
50 0.36
51 0.36
52 0.38
53 0.33
54 0.33
55 0.33
56 0.37
57 0.34
58 0.31
59 0.32
60 0.29
61 0.31
62 0.3
63 0.31
64 0.27
65 0.25
66 0.26
67 0.23
68 0.23
69 0.22
70 0.22
71 0.2
72 0.14
73 0.1
74 0.1
75 0.08
76 0.07
77 0.08
78 0.06
79 0.06
80 0.06
81 0.08
82 0.09
83 0.12
84 0.12
85 0.12
86 0.12
87 0.18
88 0.18
89 0.2
90 0.21
91 0.19
92 0.19
93 0.21
94 0.23
95 0.17
96 0.17
97 0.14
98 0.11
99 0.12
100 0.12
101 0.09
102 0.07
103 0.09
104 0.09
105 0.1
106 0.14
107 0.13
108 0.16
109 0.17
110 0.2
111 0.2
112 0.22
113 0.21
114 0.17
115 0.21
116 0.19
117 0.19
118 0.15
119 0.13
120 0.11
121 0.1
122 0.1
123 0.07
124 0.13
125 0.15
126 0.15
127 0.17
128 0.18
129 0.2
130 0.3
131 0.36
132 0.37
133 0.44
134 0.44
135 0.45
136 0.53
137 0.52
138 0.43
139 0.45
140 0.43
141 0.4
142 0.47
143 0.49
144 0.42
145 0.42
146 0.41
147 0.33
148 0.3
149 0.24
150 0.18
151 0.17
152 0.22
153 0.21
154 0.2
155 0.2
156 0.2
157 0.23
158 0.2
159 0.2
160 0.16
161 0.18
162 0.18
163 0.22
164 0.26
165 0.25
166 0.27
167 0.26
168 0.25
169 0.22
170 0.21
171 0.17
172 0.13
173 0.09
174 0.07
175 0.05
176 0.03
177 0.03
178 0.04
179 0.04
180 0.04
181 0.04
182 0.06
183 0.06
184 0.07
185 0.12
186 0.16
187 0.21
188 0.31
189 0.39
190 0.42
191 0.48
192 0.52
193 0.56
194 0.6
195 0.6
196 0.54
197 0.49
198 0.44
199 0.4
200 0.36
201 0.29
202 0.22
203 0.17
204 0.14
205 0.11
206 0.11
207 0.09
208 0.09
209 0.08
210 0.08
211 0.06
212 0.06
213 0.06
214 0.06
215 0.07
216 0.07
217 0.07
218 0.09
219 0.09
220 0.1
221 0.11
222 0.11
223 0.1
224 0.1
225 0.08
226 0.07
227 0.07
228 0.05
229 0.05
230 0.04
231 0.05
232 0.05
233 0.05
234 0.04
235 0.03
236 0.03
237 0.03
238 0.04
239 0.03
240 0.04
241 0.04
242 0.05
243 0.05
244 0.06
245 0.06
246 0.07
247 0.07
248 0.07
249 0.08
250 0.11
251 0.11
252 0.13
253 0.15
254 0.14
255 0.14
256 0.16
257 0.16
258 0.16
259 0.2
260 0.19
261 0.2
262 0.23
263 0.28
264 0.3
265 0.36
266 0.41
267 0.47
268 0.55
269 0.58
270 0.58
271 0.6
272 0.6
273 0.57
274 0.59
275 0.57
276 0.53
277 0.54
278 0.52
279 0.47
280 0.43
281 0.38
282 0.29
283 0.21
284 0.15
285 0.1
286 0.08
287 0.07
288 0.07
289 0.08
290 0.07
291 0.06
292 0.06
293 0.05
294 0.05
295 0.04
296 0.04
297 0.03
298 0.03
299 0.03
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.05
306 0.05
307 0.05
308 0.04
309 0.05
310 0.04
311 0.05
312 0.06
313 0.05
314 0.06
315 0.07
316 0.07
317 0.06
318 0.07
319 0.07
320 0.06
321 0.07
322 0.08
323 0.08
324 0.08
325 0.08
326 0.09
327 0.11
328 0.11
329 0.11
330 0.09
331 0.11
332 0.11
333 0.13
334 0.14
335 0.11
336 0.11
337 0.12
338 0.11
339 0.1
340 0.09
341 0.08
342 0.06
343 0.05
344 0.05
345 0.04
346 0.04
347 0.03
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.03
354 0.05
355 0.05
356 0.07
357 0.09
358 0.1
359 0.1
360 0.13
361 0.14
362 0.15
363 0.19
364 0.22
365 0.25
366 0.29
367 0.38
368 0.43
369 0.53
370 0.61
371 0.66
372 0.71
373 0.79