Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059JJS2

Protein Details
Accession A0A059JJS2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-29APSASAGGKKQKKKWSKGKVKDKAVHAVHydrophilic
NLS Segment(s)
PositionSequence
8-24GGKKQKKKWSKGKVKDK
Subcellular Location(s) mito 15, mito_nucl 11.5, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPSASAGGKKQKKKWSKGKVKDKAVHAVVLDKTTSEKLYKDVQSYRLITVATLVDRLKINGSLARKALADLEEKGQIKKVVGHSKMNIYTRAVAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.84
4 0.87
5 0.89
6 0.92
7 0.92
8 0.92
9 0.88
10 0.82
11 0.79
12 0.69
13 0.6
14 0.49
15 0.43
16 0.34
17 0.28
18 0.23
19 0.15
20 0.14
21 0.14
22 0.15
23 0.11
24 0.11
25 0.13
26 0.19
27 0.21
28 0.24
29 0.25
30 0.28
31 0.31
32 0.32
33 0.29
34 0.24
35 0.22
36 0.17
37 0.16
38 0.13
39 0.08
40 0.09
41 0.08
42 0.09
43 0.09
44 0.1
45 0.1
46 0.09
47 0.1
48 0.12
49 0.15
50 0.16
51 0.16
52 0.17
53 0.16
54 0.16
55 0.17
56 0.15
57 0.15
58 0.13
59 0.15
60 0.2
61 0.21
62 0.21
63 0.23
64 0.22
65 0.21
66 0.25
67 0.31
68 0.35
69 0.39
70 0.44
71 0.44
72 0.51
73 0.57
74 0.54
75 0.49
76 0.42
77 0.41