Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059JCJ8

Protein Details
Accession A0A059JCJ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-57VTPRRRWRSHPRGPEQDTKTBasic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MDARLRGAGTREQFFRQHICRCHQTGRPRSALFARCLVTPRRRWRSHPRGPEQDTKTPWGTRSSHSETPAWPITLADGTGTRTLAKRISRKRFSGEGEAFRTGYGVESQRLRAEFFAVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.42
4 0.45
5 0.46
6 0.51
7 0.54
8 0.56
9 0.6
10 0.59
11 0.63
12 0.64
13 0.65
14 0.65
15 0.58
16 0.56
17 0.57
18 0.55
19 0.47
20 0.42
21 0.36
22 0.3
23 0.33
24 0.36
25 0.36
26 0.41
27 0.49
28 0.54
29 0.57
30 0.63
31 0.71
32 0.76
33 0.78
34 0.79
35 0.77
36 0.77
37 0.79
38 0.8
39 0.75
40 0.7
41 0.62
42 0.56
43 0.5
44 0.41
45 0.36
46 0.32
47 0.28
48 0.24
49 0.3
50 0.33
51 0.33
52 0.35
53 0.34
54 0.3
55 0.34
56 0.33
57 0.26
58 0.19
59 0.15
60 0.14
61 0.13
62 0.12
63 0.08
64 0.06
65 0.08
66 0.09
67 0.09
68 0.09
69 0.1
70 0.11
71 0.16
72 0.22
73 0.3
74 0.4
75 0.5
76 0.56
77 0.6
78 0.64
79 0.66
80 0.64
81 0.65
82 0.61
83 0.57
84 0.54
85 0.53
86 0.46
87 0.39
88 0.34
89 0.24
90 0.19
91 0.17
92 0.15
93 0.16
94 0.19
95 0.21
96 0.25
97 0.26
98 0.27
99 0.23