Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059J6L7

Protein Details
Accession A0A059J6L7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
56-97SSQPRNVAKRKKRSYIKYQNNNKKKKKKQRKEREPLGLVKSRHydrophilic
NLS Segment(s)
PositionSequence
63-104AKRKKRSYIKYQNNNKKKKKKQRKEREPLGLVKSRDIKSPKP
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MSPPSKREFDIDAYLKFLGSGIRGRQTLAINNKQSEAEGWSAGEGQSLSQYLNSLSSQPRNVAKRKKRSYIKYQNNNKKKKKKQRKEREPLGLVKSRDIKSPKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.26
4 0.21
5 0.13
6 0.11
7 0.14
8 0.15
9 0.19
10 0.19
11 0.2
12 0.24
13 0.25
14 0.3
15 0.34
16 0.39
17 0.38
18 0.39
19 0.4
20 0.36
21 0.34
22 0.28
23 0.22
24 0.15
25 0.11
26 0.1
27 0.09
28 0.1
29 0.09
30 0.09
31 0.06
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.08
42 0.09
43 0.12
44 0.13
45 0.15
46 0.21
47 0.25
48 0.33
49 0.41
50 0.49
51 0.58
52 0.65
53 0.72
54 0.76
55 0.79
56 0.83
57 0.83
58 0.85
59 0.85
60 0.88
61 0.89
62 0.9
63 0.92
64 0.92
65 0.92
66 0.92
67 0.93
68 0.93
69 0.93
70 0.95
71 0.96
72 0.96
73 0.97
74 0.96
75 0.95
76 0.9
77 0.86
78 0.82
79 0.78
80 0.67
81 0.63
82 0.61
83 0.51
84 0.53