Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059JK65

Protein Details
Accession A0A059JK65    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
62-89PKNTKAPIVKANKKNKRSKRLYPSIRAPHydrophilic
NLS Segment(s)
PositionSequence
64-81NTKAPIVKANKKNKRSKR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences IKEENIKKLEKALENKALRKILEAFKTSSTYFIEIEALIPPIKNLDNRALLKVIKVSTKETPKNTKAPIVKANKKNKRSKRLYPSIRAPVVKEIEDTIKEIFTGEPAKVKDISKLHRVLLCYRLSAAQLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.62
4 0.58
5 0.5
6 0.47
7 0.45
8 0.42
9 0.42
10 0.4
11 0.36
12 0.35
13 0.38
14 0.35
15 0.31
16 0.26
17 0.22
18 0.19
19 0.17
20 0.15
21 0.12
22 0.12
23 0.11
24 0.1
25 0.09
26 0.08
27 0.07
28 0.08
29 0.1
30 0.11
31 0.12
32 0.16
33 0.22
34 0.24
35 0.26
36 0.26
37 0.24
38 0.24
39 0.24
40 0.21
41 0.17
42 0.17
43 0.18
44 0.22
45 0.3
46 0.34
47 0.37
48 0.44
49 0.45
50 0.49
51 0.47
52 0.48
53 0.43
54 0.42
55 0.45
56 0.47
57 0.52
58 0.56
59 0.65
60 0.68
61 0.74
62 0.8
63 0.82
64 0.83
65 0.82
66 0.83
67 0.83
68 0.85
69 0.84
70 0.81
71 0.8
72 0.77
73 0.74
74 0.64
75 0.56
76 0.51
77 0.45
78 0.38
79 0.3
80 0.24
81 0.22
82 0.22
83 0.22
84 0.16
85 0.13
86 0.13
87 0.13
88 0.11
89 0.11
90 0.12
91 0.11
92 0.15
93 0.16
94 0.19
95 0.21
96 0.22
97 0.27
98 0.32
99 0.37
100 0.4
101 0.43
102 0.44
103 0.44
104 0.47
105 0.44
106 0.44
107 0.4
108 0.34
109 0.32
110 0.29