Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059J923

Protein Details
Accession A0A059J923   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
113-132DEEVRPSRRVSPRKGKRVDYBasic
NLS Segment(s)
PositionSequence
124-127PRKG
Subcellular Location(s) mito 17.5, mito_nucl 13.333, nucl 8, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MLQLRLLRPSLGSLPLLPSLGRRPTTRTTRQVSSNASDGINTDRGEYSKTGGDSEVASQRSAYDICYRDPADVRTASDLEEEANGHRDRRPLEVSPANREVSRFTDEGGGQHDEEVRPSRRVSPRKGKRVDYGGADISSHPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.17
5 0.17
6 0.2
7 0.25
8 0.27
9 0.26
10 0.31
11 0.39
12 0.49
13 0.55
14 0.57
15 0.57
16 0.59
17 0.63
18 0.62
19 0.58
20 0.52
21 0.46
22 0.4
23 0.33
24 0.28
25 0.24
26 0.21
27 0.2
28 0.17
29 0.15
30 0.14
31 0.14
32 0.16
33 0.16
34 0.14
35 0.14
36 0.14
37 0.13
38 0.13
39 0.13
40 0.12
41 0.14
42 0.16
43 0.14
44 0.14
45 0.13
46 0.13
47 0.14
48 0.13
49 0.12
50 0.13
51 0.13
52 0.14
53 0.18
54 0.18
55 0.18
56 0.19
57 0.19
58 0.17
59 0.16
60 0.16
61 0.14
62 0.14
63 0.13
64 0.12
65 0.11
66 0.08
67 0.08
68 0.07
69 0.06
70 0.11
71 0.11
72 0.11
73 0.13
74 0.16
75 0.17
76 0.21
77 0.25
78 0.22
79 0.29
80 0.35
81 0.36
82 0.4
83 0.42
84 0.39
85 0.35
86 0.34
87 0.29
88 0.26
89 0.27
90 0.21
91 0.18
92 0.21
93 0.21
94 0.21
95 0.22
96 0.21
97 0.16
98 0.17
99 0.19
100 0.15
101 0.18
102 0.23
103 0.22
104 0.23
105 0.24
106 0.33
107 0.4
108 0.48
109 0.56
110 0.61
111 0.68
112 0.76
113 0.83
114 0.8
115 0.78
116 0.77
117 0.72
118 0.66
119 0.61
120 0.54
121 0.46
122 0.41
123 0.33