Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059J309

Protein Details
Accession A0A059J309    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
150-185SQNGTRKRGLPRRSQRIAKKQRQKKAGAKRVEKASAHydrophilic
NLS Segment(s)
PositionSequence
143-199KKLRKSPSQNGTRKRGLPRRSQRIAKKQRQKKAGAKRVEKASATATNRIKKRQQRGK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLAQRPLTPPYTAPRDPEPTQYNLPQKNDTLLAELSGRCNTSLQNTLSKPTFQRLAEEVVSKSISSGSTKDTRDLEPRIHFTVSQTAQKLSQQATTTVNGIYFELTKLLPPRLQPFLLNFIGKEASEEDRYTFIINVLPWILKKLRKSPSQNGTRKRGLPRRSQRIAKKQRQKKAGAKRVEKASATATNRIKKRQQRGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.47
4 0.53
5 0.5
6 0.47
7 0.5
8 0.53
9 0.56
10 0.55
11 0.57
12 0.52
13 0.48
14 0.46
15 0.43
16 0.36
17 0.3
18 0.24
19 0.2
20 0.19
21 0.19
22 0.18
23 0.17
24 0.17
25 0.14
26 0.14
27 0.14
28 0.16
29 0.22
30 0.22
31 0.27
32 0.28
33 0.32
34 0.33
35 0.35
36 0.32
37 0.3
38 0.33
39 0.26
40 0.29
41 0.26
42 0.29
43 0.28
44 0.29
45 0.25
46 0.21
47 0.21
48 0.18
49 0.16
50 0.12
51 0.11
52 0.1
53 0.11
54 0.13
55 0.19
56 0.2
57 0.23
58 0.24
59 0.26
60 0.3
61 0.31
62 0.32
63 0.29
64 0.32
65 0.32
66 0.3
67 0.27
68 0.23
69 0.29
70 0.26
71 0.26
72 0.23
73 0.21
74 0.22
75 0.23
76 0.24
77 0.17
78 0.18
79 0.15
80 0.16
81 0.17
82 0.17
83 0.17
84 0.14
85 0.14
86 0.1
87 0.1
88 0.08
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.08
95 0.1
96 0.11
97 0.12
98 0.16
99 0.18
100 0.19
101 0.19
102 0.19
103 0.23
104 0.24
105 0.22
106 0.18
107 0.17
108 0.17
109 0.15
110 0.14
111 0.1
112 0.11
113 0.13
114 0.13
115 0.13
116 0.14
117 0.14
118 0.14
119 0.12
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.1
126 0.09
127 0.13
128 0.16
129 0.18
130 0.23
131 0.31
132 0.38
133 0.46
134 0.55
135 0.61
136 0.67
137 0.74
138 0.78
139 0.78
140 0.78
141 0.76
142 0.74
143 0.75
144 0.74
145 0.7
146 0.73
147 0.75
148 0.78
149 0.8
150 0.83
151 0.83
152 0.85
153 0.89
154 0.88
155 0.88
156 0.88
157 0.88
158 0.88
159 0.87
160 0.86
161 0.86
162 0.85
163 0.85
164 0.83
165 0.81
166 0.81
167 0.77
168 0.68
169 0.59
170 0.55
171 0.53
172 0.49
173 0.5
174 0.5
175 0.52
176 0.57
177 0.63
178 0.66
179 0.67