Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059JFX0

Protein Details
Accession A0A059JFX0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
41-62SGPPRIVKPVRRTRKPSDKELAHydrophilic
NLS Segment(s)
PositionSequence
51-55RRTRK
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MIPPSTTGVSRQPREREQENECRFFDLPWELRCKVYSYVFSGPPRIVKPVRRTRKPSDKELASSPFGRHRRTSIMLASRRFHDDVSQYLYSSYTFRIFPVQHQPSIVPNVCDLAPRYKSAVRVLRLVLGSSWTEPPESWVVNEKLGLKSMEGVHTLEILVLCDPSNPMFEPFRISKDFYTKFSCRLLHGILKDLPSLRYVVIDGYSSIERNGGLVSGLVQGIQTTKKKIRWAGPFKSSNSSSAPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.64
4 0.63
5 0.68
6 0.68
7 0.67
8 0.6
9 0.57
10 0.51
11 0.44
12 0.4
13 0.37
14 0.34
15 0.33
16 0.39
17 0.36
18 0.37
19 0.38
20 0.37
21 0.33
22 0.33
23 0.31
24 0.3
25 0.35
26 0.39
27 0.4
28 0.39
29 0.37
30 0.36
31 0.35
32 0.36
33 0.36
34 0.39
35 0.47
36 0.55
37 0.64
38 0.69
39 0.75
40 0.79
41 0.84
42 0.82
43 0.81
44 0.79
45 0.73
46 0.67
47 0.65
48 0.59
49 0.51
50 0.48
51 0.4
52 0.4
53 0.4
54 0.4
55 0.36
56 0.35
57 0.38
58 0.4
59 0.41
60 0.39
61 0.43
62 0.46
63 0.48
64 0.46
65 0.42
66 0.43
67 0.4
68 0.33
69 0.27
70 0.23
71 0.21
72 0.26
73 0.24
74 0.2
75 0.19
76 0.2
77 0.17
78 0.16
79 0.14
80 0.1
81 0.1
82 0.1
83 0.15
84 0.15
85 0.18
86 0.28
87 0.29
88 0.28
89 0.28
90 0.29
91 0.26
92 0.31
93 0.28
94 0.18
95 0.15
96 0.16
97 0.15
98 0.15
99 0.15
100 0.14
101 0.15
102 0.15
103 0.18
104 0.18
105 0.2
106 0.26
107 0.3
108 0.26
109 0.27
110 0.27
111 0.27
112 0.25
113 0.23
114 0.17
115 0.12
116 0.11
117 0.1
118 0.11
119 0.08
120 0.09
121 0.08
122 0.11
123 0.11
124 0.11
125 0.11
126 0.15
127 0.16
128 0.16
129 0.18
130 0.18
131 0.16
132 0.17
133 0.17
134 0.11
135 0.13
136 0.13
137 0.13
138 0.12
139 0.12
140 0.11
141 0.11
142 0.1
143 0.08
144 0.07
145 0.06
146 0.05
147 0.05
148 0.05
149 0.05
150 0.06
151 0.06
152 0.08
153 0.08
154 0.11
155 0.12
156 0.12
157 0.17
158 0.18
159 0.22
160 0.23
161 0.25
162 0.25
163 0.32
164 0.35
165 0.33
166 0.4
167 0.37
168 0.38
169 0.41
170 0.4
171 0.33
172 0.34
173 0.35
174 0.33
175 0.32
176 0.34
177 0.31
178 0.31
179 0.3
180 0.28
181 0.24
182 0.19
183 0.19
184 0.14
185 0.12
186 0.12
187 0.11
188 0.1
189 0.1
190 0.09
191 0.12
192 0.13
193 0.12
194 0.12
195 0.11
196 0.1
197 0.1
198 0.1
199 0.07
200 0.06
201 0.06
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.09
209 0.15
210 0.17
211 0.23
212 0.3
213 0.36
214 0.43
215 0.51
216 0.57
217 0.62
218 0.69
219 0.71
220 0.74
221 0.76
222 0.72
223 0.73
224 0.66
225 0.58