Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059J670

Protein Details
Accession A0A059J670    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
195-217QDDIERRRLLRKRVRSIEREEAEBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MCHKAVSPHHRSPAVLGFVSEDEPERGRLLNQPGVPSSTRRQRYTSPESVRLRSARLHRQPDSCPGHITPYPHIQPDRIDHLDNVAGLYHHEGPYDPVTRERNAVPVRAPVQPFLLSNQETLNATSNGRDASSLPQHNQLHGDAVPPSGPRDLADRYLSYYPRTNVMVEAPAYLQRHEGFAYGDGDTLMDPYYNQDDIERRRLLRKRVRSIEREEAEAAESASKKRDVNSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.4
3 0.32
4 0.27
5 0.26
6 0.27
7 0.22
8 0.16
9 0.14
10 0.15
11 0.16
12 0.15
13 0.15
14 0.15
15 0.21
16 0.25
17 0.3
18 0.3
19 0.32
20 0.32
21 0.35
22 0.35
23 0.33
24 0.35
25 0.38
26 0.43
27 0.44
28 0.47
29 0.51
30 0.58
31 0.63
32 0.65
33 0.62
34 0.65
35 0.67
36 0.65
37 0.64
38 0.56
39 0.49
40 0.46
41 0.46
42 0.48
43 0.52
44 0.57
45 0.56
46 0.59
47 0.6
48 0.63
49 0.62
50 0.53
51 0.47
52 0.4
53 0.4
54 0.37
55 0.37
56 0.31
57 0.32
58 0.32
59 0.32
60 0.32
61 0.28
62 0.29
63 0.31
64 0.34
65 0.29
66 0.28
67 0.24
68 0.25
69 0.24
70 0.21
71 0.18
72 0.1
73 0.08
74 0.07
75 0.1
76 0.1
77 0.09
78 0.09
79 0.09
80 0.11
81 0.15
82 0.17
83 0.15
84 0.18
85 0.2
86 0.21
87 0.23
88 0.21
89 0.25
90 0.24
91 0.25
92 0.21
93 0.22
94 0.24
95 0.26
96 0.26
97 0.19
98 0.19
99 0.19
100 0.18
101 0.16
102 0.17
103 0.13
104 0.14
105 0.13
106 0.12
107 0.12
108 0.12
109 0.13
110 0.1
111 0.1
112 0.1
113 0.1
114 0.1
115 0.09
116 0.09
117 0.07
118 0.11
119 0.17
120 0.19
121 0.19
122 0.27
123 0.28
124 0.28
125 0.29
126 0.25
127 0.21
128 0.19
129 0.19
130 0.11
131 0.11
132 0.11
133 0.1
134 0.11
135 0.09
136 0.09
137 0.08
138 0.12
139 0.13
140 0.16
141 0.18
142 0.17
143 0.2
144 0.24
145 0.24
146 0.23
147 0.26
148 0.23
149 0.24
150 0.25
151 0.22
152 0.19
153 0.2
154 0.2
155 0.15
156 0.15
157 0.13
158 0.16
159 0.16
160 0.16
161 0.16
162 0.14
163 0.15
164 0.15
165 0.15
166 0.12
167 0.13
168 0.14
169 0.12
170 0.12
171 0.1
172 0.1
173 0.09
174 0.09
175 0.07
176 0.05
177 0.05
178 0.08
179 0.11
180 0.11
181 0.12
182 0.14
183 0.21
184 0.26
185 0.34
186 0.36
187 0.35
188 0.44
189 0.51
190 0.59
191 0.63
192 0.68
193 0.71
194 0.77
195 0.84
196 0.81
197 0.83
198 0.83
199 0.75
200 0.68
201 0.58
202 0.49
203 0.41
204 0.35
205 0.26
206 0.2
207 0.2
208 0.17
209 0.2
210 0.23
211 0.22
212 0.27