Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059JEM3

Protein Details
Accession A0A059JEM3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-31EVPLKLSKRKNHTAKYLPRGYRKNKRDNIMHydrophilic
NLS Segment(s)
PositionSequence
9-27KRKNHTAKYLPRGYRKNKR
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MEVPLKLSKRKNHTAKYLPRGYRKNKRDNIMGIKKTNNVSTTAKPAIRRLARRGGVVRIQKAIYKTVREVVVSRLQTILEQVVMLLESTDTPAKTRKTVTTSDIVFVLKRLGTSVYGFDHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.83
4 0.84
5 0.81
6 0.81
7 0.82
8 0.82
9 0.82
10 0.82
11 0.83
12 0.81
13 0.79
14 0.76
15 0.75
16 0.76
17 0.75
18 0.71
19 0.64
20 0.6
21 0.58
22 0.53
23 0.47
24 0.38
25 0.32
26 0.3
27 0.28
28 0.32
29 0.32
30 0.33
31 0.31
32 0.33
33 0.37
34 0.39
35 0.41
36 0.4
37 0.44
38 0.44
39 0.45
40 0.45
41 0.4
42 0.4
43 0.4
44 0.36
45 0.29
46 0.28
47 0.26
48 0.25
49 0.26
50 0.22
51 0.2
52 0.2
53 0.21
54 0.21
55 0.2
56 0.2
57 0.19
58 0.24
59 0.22
60 0.22
61 0.19
62 0.18
63 0.17
64 0.17
65 0.13
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.03
74 0.03
75 0.05
76 0.07
77 0.07
78 0.09
79 0.15
80 0.17
81 0.2
82 0.24
83 0.28
84 0.31
85 0.35
86 0.37
87 0.39
88 0.38
89 0.36
90 0.34
91 0.3
92 0.25
93 0.22
94 0.2
95 0.13
96 0.12
97 0.12
98 0.12
99 0.13
100 0.15
101 0.17