Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KM90

Protein Details
Accession J3KM90   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
38-59LMTKQFVKSKSKKYHKHQLMVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
KEGG cim:CIMG_12619  -  
Amino Acid Sequences MDHKTCHDVLKRIQAKHEWQNNSKKDHKMIEDKVIKELMTKQFVKSKSKKYHKHQLMVSQQKKREKEKKCY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.6
4 0.63
5 0.59
6 0.6
7 0.68
8 0.67
9 0.68
10 0.67
11 0.62
12 0.58
13 0.55
14 0.53
15 0.52
16 0.5
17 0.52
18 0.51
19 0.48
20 0.45
21 0.4
22 0.34
23 0.27
24 0.29
25 0.23
26 0.23
27 0.23
28 0.23
29 0.29
30 0.33
31 0.41
32 0.43
33 0.49
34 0.55
35 0.64
36 0.72
37 0.75
38 0.83
39 0.83
40 0.83
41 0.78
42 0.77
43 0.77
44 0.79
45 0.79
46 0.76
47 0.75
48 0.75
49 0.77
50 0.78
51 0.77