Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059IZ92

Protein Details
Accession A0A059IZ92   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-30TTQYRGGQQQQQQHRQQKKESETDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005549  Kinetochore_Nuf2_N  
IPR041112  Nuf2_DHR10-like  
IPR038275  Nuf2_N_sf  
Gene Ontology GO:0031262  C:Ndc80 complex  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF03800  Nuf2  
PF18595  Nuf2_DHR10-like  
Amino Acid Sequences MAYNSRTTQYRGGQQQQQQHRQQKKESETDAFLRLPDKVIAGCINDIGIPFTMADLLKPNPQQVQMVFEWFAELFMNTTRETVEPAMLAAAEDIAGDQADIFPPDTRNLMGFLVSLRKLMLQCGVHDFTFTDITRPTYDRIAKIFSYLINFVRFRESQTSAIDAHFNKSEDTKMRIETLYAENQELEQRLEEMKRQQKEMDGVVREKTSRNDELKTRLLELRRNQERVAETFERVKGEKARKQTLLEEKTEKLLKSRQECEKLRPYVSQSPESLQSALTELSDNLAHDKSQVDGMERRMRALQTSMNTFTVVNNEVQSSIKLLEDILVELQKEDDQESKGIKNREALAERGNTVREVAHTEKLLQSQLARWQERIEALRKSSREKAEQAQARMEELHSVQKQLREERAEKQREMERRRIRIEQTEKKMADLKETIEDEIHRAHDEYLKMESHIKLYTTEIEKCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.74
4 0.78
5 0.79
6 0.8
7 0.81
8 0.8
9 0.82
10 0.83
11 0.8
12 0.79
13 0.75
14 0.71
15 0.67
16 0.63
17 0.58
18 0.49
19 0.42
20 0.34
21 0.29
22 0.25
23 0.21
24 0.19
25 0.14
26 0.16
27 0.17
28 0.18
29 0.17
30 0.15
31 0.14
32 0.13
33 0.13
34 0.12
35 0.1
36 0.09
37 0.08
38 0.08
39 0.1
40 0.09
41 0.1
42 0.12
43 0.14
44 0.2
45 0.21
46 0.24
47 0.25
48 0.27
49 0.3
50 0.27
51 0.31
52 0.26
53 0.28
54 0.26
55 0.22
56 0.22
57 0.18
58 0.18
59 0.12
60 0.11
61 0.08
62 0.1
63 0.12
64 0.11
65 0.11
66 0.12
67 0.12
68 0.15
69 0.15
70 0.13
71 0.12
72 0.11
73 0.11
74 0.1
75 0.09
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.04
87 0.05
88 0.06
89 0.08
90 0.1
91 0.11
92 0.12
93 0.13
94 0.13
95 0.14
96 0.13
97 0.12
98 0.11
99 0.11
100 0.14
101 0.14
102 0.14
103 0.12
104 0.14
105 0.14
106 0.15
107 0.19
108 0.16
109 0.17
110 0.23
111 0.25
112 0.22
113 0.22
114 0.21
115 0.17
116 0.21
117 0.19
118 0.15
119 0.14
120 0.17
121 0.19
122 0.2
123 0.2
124 0.23
125 0.26
126 0.27
127 0.28
128 0.3
129 0.27
130 0.27
131 0.27
132 0.21
133 0.2
134 0.2
135 0.19
136 0.2
137 0.2
138 0.2
139 0.24
140 0.23
141 0.23
142 0.27
143 0.28
144 0.26
145 0.27
146 0.28
147 0.24
148 0.24
149 0.25
150 0.2
151 0.19
152 0.19
153 0.18
154 0.16
155 0.16
156 0.2
157 0.19
158 0.23
159 0.22
160 0.21
161 0.23
162 0.22
163 0.22
164 0.21
165 0.21
166 0.21
167 0.2
168 0.19
169 0.17
170 0.17
171 0.19
172 0.16
173 0.13
174 0.09
175 0.09
176 0.1
177 0.11
178 0.14
179 0.2
180 0.26
181 0.28
182 0.29
183 0.29
184 0.3
185 0.32
186 0.33
187 0.3
188 0.26
189 0.26
190 0.26
191 0.26
192 0.24
193 0.23
194 0.22
195 0.21
196 0.25
197 0.26
198 0.28
199 0.3
200 0.34
201 0.37
202 0.35
203 0.33
204 0.3
205 0.3
206 0.33
207 0.35
208 0.4
209 0.41
210 0.42
211 0.39
212 0.4
213 0.39
214 0.35
215 0.37
216 0.28
217 0.24
218 0.25
219 0.26
220 0.24
221 0.22
222 0.23
223 0.23
224 0.29
225 0.32
226 0.35
227 0.4
228 0.4
229 0.42
230 0.46
231 0.49
232 0.45
233 0.44
234 0.41
235 0.36
236 0.37
237 0.38
238 0.32
239 0.25
240 0.26
241 0.28
242 0.31
243 0.37
244 0.4
245 0.47
246 0.49
247 0.53
248 0.58
249 0.55
250 0.52
251 0.47
252 0.46
253 0.45
254 0.46
255 0.42
256 0.34
257 0.32
258 0.33
259 0.31
260 0.25
261 0.18
262 0.14
263 0.12
264 0.11
265 0.1
266 0.08
267 0.06
268 0.07
269 0.07
270 0.07
271 0.08
272 0.08
273 0.08
274 0.08
275 0.09
276 0.08
277 0.1
278 0.11
279 0.12
280 0.14
281 0.2
282 0.27
283 0.26
284 0.27
285 0.27
286 0.27
287 0.25
288 0.25
289 0.23
290 0.19
291 0.23
292 0.24
293 0.22
294 0.23
295 0.21
296 0.19
297 0.18
298 0.17
299 0.13
300 0.12
301 0.11
302 0.12
303 0.12
304 0.12
305 0.1
306 0.1
307 0.09
308 0.08
309 0.08
310 0.08
311 0.08
312 0.09
313 0.08
314 0.08
315 0.08
316 0.08
317 0.09
318 0.08
319 0.09
320 0.09
321 0.11
322 0.11
323 0.14
324 0.16
325 0.2
326 0.25
327 0.27
328 0.28
329 0.3
330 0.31
331 0.36
332 0.36
333 0.34
334 0.34
335 0.33
336 0.33
337 0.3
338 0.28
339 0.21
340 0.19
341 0.18
342 0.14
343 0.18
344 0.19
345 0.21
346 0.21
347 0.22
348 0.24
349 0.25
350 0.25
351 0.2
352 0.18
353 0.18
354 0.25
355 0.32
356 0.31
357 0.3
358 0.3
359 0.32
360 0.36
361 0.37
362 0.35
363 0.31
364 0.34
365 0.41
366 0.42
367 0.45
368 0.48
369 0.5
370 0.51
371 0.51
372 0.54
373 0.57
374 0.61
375 0.58
376 0.56
377 0.5
378 0.45
379 0.41
380 0.34
381 0.27
382 0.22
383 0.28
384 0.23
385 0.25
386 0.27
387 0.3
388 0.35
389 0.38
390 0.44
391 0.43
392 0.45
393 0.51
394 0.59
395 0.62
396 0.58
397 0.58
398 0.59
399 0.61
400 0.65
401 0.66
402 0.65
403 0.67
404 0.72
405 0.73
406 0.71
407 0.72
408 0.75
409 0.75
410 0.74
411 0.75
412 0.69
413 0.65
414 0.66
415 0.56
416 0.52
417 0.44
418 0.38
419 0.36
420 0.37
421 0.35
422 0.3
423 0.3
424 0.26
425 0.26
426 0.25
427 0.2
428 0.19
429 0.2
430 0.24
431 0.24
432 0.24
433 0.25
434 0.24
435 0.24
436 0.28
437 0.27
438 0.26
439 0.27
440 0.25
441 0.23
442 0.25
443 0.31
444 0.31