Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059IXP5

Protein Details
Accession A0A059IXP5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-36ASESPGKSGKGRHRCRRYRRTCEKRRSEVENIBasic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTATASESPGKSGKGRHRCRRYRRTCEKRRSEVENIQIGARSRDPALSSSVSFGFQVSWHKSAWRSFLMEDEDEDEAVRKQRKSFPHLASRIRPLAQLNSHASAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.56
3 0.64
4 0.73
5 0.81
6 0.89
7 0.92
8 0.93
9 0.93
10 0.94
11 0.94
12 0.94
13 0.94
14 0.93
15 0.91
16 0.87
17 0.83
18 0.79
19 0.75
20 0.71
21 0.65
22 0.55
23 0.46
24 0.42
25 0.35
26 0.29
27 0.23
28 0.17
29 0.12
30 0.12
31 0.13
32 0.12
33 0.14
34 0.13
35 0.13
36 0.13
37 0.13
38 0.13
39 0.12
40 0.11
41 0.08
42 0.07
43 0.12
44 0.14
45 0.15
46 0.14
47 0.16
48 0.19
49 0.2
50 0.23
51 0.21
52 0.19
53 0.18
54 0.21
55 0.23
56 0.21
57 0.19
58 0.18
59 0.16
60 0.14
61 0.14
62 0.12
63 0.1
64 0.15
65 0.2
66 0.19
67 0.23
68 0.3
69 0.37
70 0.45
71 0.53
72 0.55
73 0.61
74 0.67
75 0.71
76 0.7
77 0.7
78 0.67
79 0.58
80 0.53
81 0.46
82 0.46
83 0.42
84 0.42
85 0.4