Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KDS0

Protein Details
Accession J3KDS0   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-102PKRPAFPPPRTPGKRRRMTIBasic
NLS Segment(s)
PositionSequence
84-99KRPAFPPPRTPGKRRR
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
KEGG cim:CIMG_04561  -  
Amino Acid Sequences MFRRMRGALGGSRLYMLPGPTASQTKTPRSSQKLWRLRRFLHLVGTSRIRQNSHPKEAMLDKSGHAKRLVTKQYHESWLNDSPKRPAFPPPRTPGKRRRMTIRALSRVQSALYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.16
4 0.12
5 0.11
6 0.12
7 0.14
8 0.17
9 0.17
10 0.23
11 0.28
12 0.33
13 0.38
14 0.42
15 0.49
16 0.53
17 0.6
18 0.62
19 0.67
20 0.7
21 0.75
22 0.78
23 0.76
24 0.71
25 0.71
26 0.67
27 0.58
28 0.55
29 0.49
30 0.43
31 0.39
32 0.4
33 0.35
34 0.32
35 0.32
36 0.27
37 0.28
38 0.36
39 0.4
40 0.42
41 0.41
42 0.38
43 0.39
44 0.4
45 0.37
46 0.28
47 0.22
48 0.16
49 0.24
50 0.25
51 0.24
52 0.22
53 0.22
54 0.24
55 0.32
56 0.38
57 0.32
58 0.34
59 0.38
60 0.41
61 0.46
62 0.43
63 0.36
64 0.34
65 0.39
66 0.43
67 0.4
68 0.37
69 0.38
70 0.4
71 0.41
72 0.37
73 0.4
74 0.43
75 0.5
76 0.58
77 0.6
78 0.66
79 0.71
80 0.78
81 0.79
82 0.8
83 0.8
84 0.77
85 0.79
86 0.75
87 0.77
88 0.79
89 0.79
90 0.77
91 0.71
92 0.67
93 0.6
94 0.54