Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059J4B2

Protein Details
Accession A0A059J4B2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
5-28NSVTRSLKRICNRARNRYREHSTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
Amino Acid Sequences MQNINSVTRSLKRICNRARNRYREHSTPGNGRRAGKPEGGEDGAARDLFPPLSPILSPLESGLETTDAPCGVVEEPLHFVTLWTYQHATQQLDTSNINVLMTLRQASKNVTMSHQHAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.73
4 0.78
5 0.84
6 0.84
7 0.85
8 0.85
9 0.82
10 0.77
11 0.74
12 0.71
13 0.67
14 0.67
15 0.65
16 0.63
17 0.59
18 0.57
19 0.54
20 0.51
21 0.48
22 0.41
23 0.36
24 0.3
25 0.3
26 0.28
27 0.24
28 0.19
29 0.17
30 0.15
31 0.13
32 0.11
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.08
42 0.09
43 0.09
44 0.09
45 0.08
46 0.09
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.06
58 0.05
59 0.07
60 0.06
61 0.07
62 0.1
63 0.1
64 0.11
65 0.1
66 0.09
67 0.09
68 0.12
69 0.12
70 0.12
71 0.13
72 0.13
73 0.17
74 0.21
75 0.21
76 0.19
77 0.21
78 0.2
79 0.21
80 0.21
81 0.18
82 0.17
83 0.16
84 0.14
85 0.12
86 0.11
87 0.1
88 0.11
89 0.13
90 0.13
91 0.14
92 0.16
93 0.19
94 0.24
95 0.28
96 0.29
97 0.31
98 0.34