Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059IXQ5

Protein Details
Accession A0A059IXQ5    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
38-57EVRPTRPKKKVVKKVEQTVSHydrophilic
NLS Segment(s)
PositionSequence
44-47PKKK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR011068  NuclTrfase_I-like_C  
IPR007010  PolA_pol_RNA-bd_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016779  F:nucleotidyltransferase activity  
GO:0003723  F:RNA binding  
GO:0031123  P:RNA 3'-end processing  
GO:0043631  P:RNA polyadenylation  
Pfam View protein in Pfam  
PF04926  PAP_RNA-bind  
Amino Acid Sequences MFKNTCTSWAQYQPGVNDLNISHVRNYDLPDDVFQPGEVRPTRPKKKVVKKVEQTVSQKRNIDAVDGQEISESASKRHVSQNGMVTQATIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.28
4 0.22
5 0.19
6 0.22
7 0.22
8 0.22
9 0.19
10 0.19
11 0.21
12 0.21
13 0.23
14 0.18
15 0.17
16 0.17
17 0.17
18 0.18
19 0.16
20 0.15
21 0.13
22 0.12
23 0.1
24 0.15
25 0.14
26 0.16
27 0.24
28 0.33
29 0.42
30 0.45
31 0.54
32 0.59
33 0.69
34 0.76
35 0.78
36 0.78
37 0.78
38 0.82
39 0.8
40 0.77
41 0.74
42 0.74
43 0.69
44 0.64
45 0.58
46 0.49
47 0.47
48 0.39
49 0.34
50 0.26
51 0.24
52 0.23
53 0.21
54 0.2
55 0.16
56 0.16
57 0.14
58 0.16
59 0.14
60 0.11
61 0.16
62 0.17
63 0.2
64 0.28
65 0.31
66 0.32
67 0.37
68 0.44
69 0.42
70 0.43
71 0.4