Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059JBW4

Protein Details
Accession A0A059JBW4   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
99-127GVLHQHKENWPRFRRTRRRYGQGKAQGQVHydrophilic
NLS Segment(s)
PositionSequence
95-117KIRRGVLHQHKENWPRFRRTRRR
Subcellular Location(s) cyto_nucl 8.333, nucl 8, mito 8, cyto 6.5, cyto_pero 5.166, pero 2.5
Family & Domain DBs
Amino Acid Sequences MSVTSLTQPTEVSWPCTSAPVPGYEVRRDMMRLILTHAFPPAVEIKYQRRLLSQLGSDIAAKQPSRRRGMGGIRQGRRVEWDQIRGQAVAWRPQKIRRGVLHQHKENWPRFRRTRRRYGQGKAQGQVFTSIRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.26
4 0.25
5 0.21
6 0.21
7 0.18
8 0.21
9 0.24
10 0.27
11 0.27
12 0.28
13 0.26
14 0.26
15 0.24
16 0.22
17 0.21
18 0.19
19 0.17
20 0.2
21 0.22
22 0.21
23 0.21
24 0.2
25 0.16
26 0.14
27 0.15
28 0.15
29 0.12
30 0.12
31 0.16
32 0.21
33 0.29
34 0.32
35 0.31
36 0.29
37 0.3
38 0.32
39 0.31
40 0.26
41 0.2
42 0.17
43 0.17
44 0.16
45 0.14
46 0.13
47 0.12
48 0.11
49 0.15
50 0.2
51 0.26
52 0.3
53 0.3
54 0.3
55 0.33
56 0.41
57 0.44
58 0.47
59 0.49
60 0.47
61 0.51
62 0.49
63 0.44
64 0.41
65 0.36
66 0.34
67 0.29
68 0.32
69 0.3
70 0.32
71 0.34
72 0.29
73 0.26
74 0.23
75 0.22
76 0.25
77 0.27
78 0.29
79 0.3
80 0.36
81 0.43
82 0.45
83 0.5
84 0.47
85 0.53
86 0.58
87 0.67
88 0.7
89 0.68
90 0.69
91 0.7
92 0.74
93 0.73
94 0.74
95 0.7
96 0.7
97 0.74
98 0.79
99 0.82
100 0.82
101 0.85
102 0.85
103 0.88
104 0.88
105 0.87
106 0.86
107 0.85
108 0.83
109 0.76
110 0.7
111 0.61
112 0.53
113 0.51
114 0.4