Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059J7E6

Protein Details
Accession A0A059J7E6   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLNRPQKKRDRAPEPPQVKRDEBasic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039454  OM14  
IPR039453  OM14_C  
IPR000297  PPIase_PpiC  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
GO:1990593  F:nascent polypeptide-associated complex binding  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
Pfam View protein in Pfam  
PF17304  DUF5353  
PF00639  Rotamase  
Amino Acid Sequences MLNRPQKKRDRAPEPPQVKRDENNASNLVDVDSPHVSTVPSDFNAQEIKTKTQEARVELEKEQEELKKKYREGKQKAKETAKDVSERAQEAAAGGYDKFDRNKSNPVVIGNMVLLTAASAGLAYGAYQKHLRGALTWELVAAWTGGIGALGLFDYYVSRWFFQNKYPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.81
4 0.77
5 0.72
6 0.65
7 0.63
8 0.62
9 0.56
10 0.52
11 0.49
12 0.42
13 0.38
14 0.35
15 0.28
16 0.19
17 0.16
18 0.14
19 0.12
20 0.12
21 0.11
22 0.11
23 0.1
24 0.1
25 0.12
26 0.11
27 0.12
28 0.13
29 0.13
30 0.14
31 0.17
32 0.16
33 0.2
34 0.2
35 0.22
36 0.22
37 0.26
38 0.25
39 0.3
40 0.33
41 0.3
42 0.32
43 0.33
44 0.34
45 0.31
46 0.34
47 0.28
48 0.25
49 0.25
50 0.24
51 0.26
52 0.26
53 0.33
54 0.34
55 0.36
56 0.43
57 0.49
58 0.56
59 0.6
60 0.67
61 0.69
62 0.73
63 0.79
64 0.76
65 0.72
66 0.65
67 0.6
68 0.52
69 0.45
70 0.37
71 0.32
72 0.28
73 0.25
74 0.21
75 0.16
76 0.13
77 0.11
78 0.11
79 0.07
80 0.06
81 0.05
82 0.05
83 0.06
84 0.07
85 0.09
86 0.11
87 0.15
88 0.17
89 0.25
90 0.26
91 0.28
92 0.29
93 0.28
94 0.28
95 0.25
96 0.23
97 0.15
98 0.13
99 0.09
100 0.07
101 0.06
102 0.04
103 0.03
104 0.03
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.03
111 0.06
112 0.06
113 0.08
114 0.1
115 0.1
116 0.13
117 0.15
118 0.15
119 0.13
120 0.18
121 0.21
122 0.21
123 0.21
124 0.18
125 0.16
126 0.16
127 0.15
128 0.1
129 0.05
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.05
143 0.09
144 0.12
145 0.13
146 0.16
147 0.21
148 0.23
149 0.31