Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015N7M6

Protein Details
Accession A0A015N7M6   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MARRKSTARAPKQKRTASTSHydrophilic
NLS Segment(s)
PositionSequence
11-12PK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010625  CHCH  
IPR009069  Cys_alpha_HP_mot_SF  
Pfam View protein in Pfam  
PF06747  CHCH  
Amino Acid Sequences MARRKSTARAPKQKRTASTSSARPNPPPTKPAQQANANVPAVPSRQPTKLAEQRSPGLFGQMASTAAGVAVGHSIGHGITGLFSGGSSSETPASQDSQSQYTPQTQDVQPQYQAYQNDSYGGASCEKDAKALTKCLELNNHNISLCQYYLENLKACQQMASQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.75
4 0.71
5 0.69
6 0.67
7 0.66
8 0.67
9 0.65
10 0.61
11 0.64
12 0.64
13 0.62
14 0.57
15 0.54
16 0.55
17 0.58
18 0.6
19 0.58
20 0.57
21 0.58
22 0.59
23 0.59
24 0.5
25 0.43
26 0.37
27 0.31
28 0.26
29 0.23
30 0.22
31 0.18
32 0.2
33 0.23
34 0.26
35 0.33
36 0.38
37 0.41
38 0.42
39 0.42
40 0.44
41 0.41
42 0.42
43 0.32
44 0.27
45 0.22
46 0.18
47 0.15
48 0.12
49 0.11
50 0.08
51 0.08
52 0.06
53 0.05
54 0.05
55 0.04
56 0.03
57 0.03
58 0.03
59 0.02
60 0.02
61 0.03
62 0.02
63 0.03
64 0.03
65 0.02
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.05
76 0.06
77 0.06
78 0.07
79 0.08
80 0.1
81 0.09
82 0.11
83 0.12
84 0.14
85 0.15
86 0.15
87 0.16
88 0.18
89 0.19
90 0.18
91 0.21
92 0.19
93 0.26
94 0.29
95 0.3
96 0.27
97 0.27
98 0.27
99 0.26
100 0.27
101 0.23
102 0.21
103 0.19
104 0.19
105 0.18
106 0.17
107 0.14
108 0.14
109 0.13
110 0.11
111 0.11
112 0.14
113 0.13
114 0.14
115 0.14
116 0.19
117 0.2
118 0.25
119 0.26
120 0.28
121 0.29
122 0.32
123 0.38
124 0.35
125 0.39
126 0.39
127 0.4
128 0.34
129 0.33
130 0.32
131 0.27
132 0.25
133 0.19
134 0.14
135 0.14
136 0.18
137 0.22
138 0.21
139 0.2
140 0.26
141 0.28
142 0.28
143 0.28