Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015L7W7

Protein Details
Accession A0A015L7W7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-52GYVYRLKKPGKRRKTTPSKQPISHydrophilic
NLS Segment(s)
PositionSequence
35-44LKKPGKRRKT
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MWRNETEEEKLYWKKIADRKKMEHVQAHPGYVYRLKKPGKRRKTTPSKQPISTLENTCVPELVTSIVNPSTID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.49
4 0.52
5 0.58
6 0.62
7 0.69
8 0.74
9 0.71
10 0.7
11 0.62
12 0.62
13 0.54
14 0.49
15 0.39
16 0.32
17 0.29
18 0.27
19 0.27
20 0.19
21 0.25
22 0.29
23 0.35
24 0.46
25 0.55
26 0.6
27 0.66
28 0.71
29 0.74
30 0.81
31 0.84
32 0.84
33 0.84
34 0.8
35 0.73
36 0.71
37 0.65
38 0.6
39 0.57
40 0.49
41 0.42
42 0.39
43 0.39
44 0.34
45 0.29
46 0.23
47 0.17
48 0.15
49 0.14
50 0.1
51 0.09
52 0.11
53 0.12