Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LP61

Protein Details
Accession A0A015LP61    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
166-190TLEEKENHKKKSKEKSERLLNLSKSHydrophilic
NLS Segment(s)
PositionSequence
175-177KKS
Subcellular Location(s) cyto_nucl 14.5, nucl 13.5, cyto 12.5
Family & Domain DBs
Amino Acid Sequences MHTQLDMDSSHQILEQIKLDDLTEKAWYVCYFELCNKCILTITQTILSVYFVDSDSSVEDYCVDVTVDFLISYDINDKIVAFHVQEVSKLLSRNTFDLDEIFNEDPPKPIYFEDSDILIVSLVYSTLPSRFLKTEIEDIKVRTDNVGNIICLSFYSASNRIAEELTLEEKENHKKKSKEKSERLLNLSKSIIHEYNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.18
5 0.18
6 0.18
7 0.18
8 0.17
9 0.16
10 0.14
11 0.13
12 0.13
13 0.15
14 0.15
15 0.15
16 0.16
17 0.17
18 0.17
19 0.24
20 0.29
21 0.27
22 0.3
23 0.27
24 0.25
25 0.24
26 0.23
27 0.2
28 0.18
29 0.2
30 0.18
31 0.18
32 0.18
33 0.17
34 0.17
35 0.13
36 0.1
37 0.09
38 0.07
39 0.08
40 0.07
41 0.08
42 0.08
43 0.09
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.05
52 0.05
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.09
68 0.07
69 0.08
70 0.1
71 0.1
72 0.1
73 0.11
74 0.12
75 0.13
76 0.13
77 0.12
78 0.13
79 0.14
80 0.15
81 0.15
82 0.14
83 0.12
84 0.13
85 0.13
86 0.1
87 0.13
88 0.12
89 0.11
90 0.11
91 0.11
92 0.12
93 0.13
94 0.13
95 0.11
96 0.1
97 0.13
98 0.14
99 0.16
100 0.15
101 0.14
102 0.14
103 0.13
104 0.12
105 0.09
106 0.07
107 0.05
108 0.04
109 0.03
110 0.03
111 0.03
112 0.04
113 0.04
114 0.08
115 0.09
116 0.11
117 0.12
118 0.14
119 0.16
120 0.18
121 0.26
122 0.25
123 0.28
124 0.28
125 0.28
126 0.3
127 0.29
128 0.27
129 0.21
130 0.2
131 0.17
132 0.2
133 0.21
134 0.16
135 0.16
136 0.15
137 0.13
138 0.12
139 0.13
140 0.09
141 0.09
142 0.14
143 0.15
144 0.17
145 0.18
146 0.18
147 0.18
148 0.17
149 0.16
150 0.12
151 0.12
152 0.13
153 0.14
154 0.15
155 0.16
156 0.21
157 0.31
158 0.37
159 0.42
160 0.48
161 0.54
162 0.63
163 0.72
164 0.78
165 0.79
166 0.82
167 0.86
168 0.88
169 0.89
170 0.87
171 0.84
172 0.75
173 0.68
174 0.59
175 0.51
176 0.44
177 0.42