Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015MY36

Protein Details
Accession A0A015MY36    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MKVKGKTKEKGKTKGKGKTKGKSKTKVRGKAKVKBasic
NLS Segment(s)
PositionSequence
4-44KGKTKEKGKTKGKGKTKGKSKTKVRGKAKVKGKTKGKGKTK
Subcellular Location(s) mito 13, nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MKVKGKTKEKGKTKGKGKTKGKSKTKVRGKAKVKGKTKGKGKTKVDGFLKNVLLRFLHVELQLTTPKDHVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.85
4 0.84
5 0.83
6 0.84
7 0.84
8 0.84
9 0.85
10 0.84
11 0.84
12 0.85
13 0.86
14 0.84
15 0.83
16 0.8
17 0.79
18 0.79
19 0.77
20 0.73
21 0.72
22 0.71
23 0.69
24 0.71
25 0.72
26 0.71
27 0.72
28 0.69
29 0.68
30 0.64
31 0.64
32 0.61
33 0.57
34 0.51
35 0.47
36 0.46
37 0.4
38 0.37
39 0.31
40 0.26
41 0.21
42 0.21
43 0.18
44 0.18
45 0.16
46 0.18
47 0.17
48 0.21
49 0.24
50 0.23
51 0.22
52 0.19