Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LFL9

Protein Details
Accession A0A015LFL9   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-92KDRMYQRCSPCNKKNPNKHEAKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 11.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MADNPPPPPPNPYVAKRPTDKWRHRGVTYCRVFGQWECEMCGKKWDSGYTWVAIKKYEQNLDVSHFKNKKDRMYQRCSPCNKKNPNKHEAKLVSFKLLENNVKLVKGPGHIRNLCGKCNKGAICDRAKVGLKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.57
4 0.61
5 0.65
6 0.68
7 0.72
8 0.71
9 0.74
10 0.73
11 0.72
12 0.74
13 0.72
14 0.72
15 0.67
16 0.61
17 0.51
18 0.46
19 0.44
20 0.36
21 0.33
22 0.26
23 0.23
24 0.22
25 0.25
26 0.26
27 0.25
28 0.3
29 0.25
30 0.24
31 0.25
32 0.24
33 0.23
34 0.26
35 0.27
36 0.23
37 0.24
38 0.24
39 0.22
40 0.21
41 0.2
42 0.21
43 0.23
44 0.24
45 0.21
46 0.22
47 0.22
48 0.26
49 0.29
50 0.24
51 0.29
52 0.29
53 0.29
54 0.34
55 0.37
56 0.4
57 0.45
58 0.53
59 0.54
60 0.6
61 0.67
62 0.69
63 0.73
64 0.74
65 0.73
66 0.73
67 0.74
68 0.77
69 0.79
70 0.81
71 0.8
72 0.82
73 0.82
74 0.74
75 0.74
76 0.67
77 0.63
78 0.6
79 0.53
80 0.46
81 0.38
82 0.37
83 0.32
84 0.33
85 0.31
86 0.24
87 0.28
88 0.25
89 0.25
90 0.25
91 0.22
92 0.19
93 0.21
94 0.26
95 0.27
96 0.36
97 0.37
98 0.39
99 0.47
100 0.48
101 0.5
102 0.51
103 0.47
104 0.41
105 0.48
106 0.46
107 0.43
108 0.48
109 0.49
110 0.49
111 0.51
112 0.49
113 0.48