Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015N9M7

Protein Details
Accession A0A015N9M7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-37NSSNSSNSRNPRNPRNPRRPSNPSNPSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTSRNSNPSNSSNSSNSRNPRNPRNPRRPSNPSNPSNLTRQLRAENAANSAAEKIKKKQDYYKDTQFHMELSTQPPSNPSNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.52
4 0.54
5 0.59
6 0.62
7 0.67
8 0.73
9 0.78
10 0.82
11 0.87
12 0.87
13 0.86
14 0.88
15 0.87
16 0.83
17 0.83
18 0.81
19 0.73
20 0.7
21 0.65
22 0.58
23 0.53
24 0.53
25 0.44
26 0.36
27 0.35
28 0.31
29 0.27
30 0.27
31 0.26
32 0.19
33 0.18
34 0.17
35 0.15
36 0.13
37 0.13
38 0.14
39 0.15
40 0.17
41 0.2
42 0.28
43 0.33
44 0.37
45 0.44
46 0.52
47 0.58
48 0.63
49 0.69
50 0.65
51 0.62
52 0.62
53 0.54
54 0.45
55 0.38
56 0.31
57 0.24
58 0.23
59 0.27
60 0.23
61 0.23
62 0.26