Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L339

Protein Details
Accession A0A015L339    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-67VQNKKLRRIKAAKNLYRKSDHydrophilic
NLS Segment(s)
PositionSequence
51-60KKLRRIKAAK
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MFLNYKPSVAQLTNWLSALHKSRRSQTQLKKSGKSDEDSRRVHNNSHVQNKKLRRIKAAKNLYRKSDERIIGYEKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.22
4 0.25
5 0.31
6 0.31
7 0.33
8 0.35
9 0.4
10 0.48
11 0.55
12 0.6
13 0.63
14 0.67
15 0.7
16 0.74
17 0.73
18 0.67
19 0.67
20 0.6
21 0.53
22 0.51
23 0.49
24 0.51
25 0.48
26 0.49
27 0.48
28 0.47
29 0.45
30 0.44
31 0.43
32 0.42
33 0.51
34 0.52
35 0.48
36 0.54
37 0.6
38 0.63
39 0.62
40 0.59
41 0.58
42 0.62
43 0.69
44 0.72
45 0.76
46 0.75
47 0.78
48 0.81
49 0.77
50 0.76
51 0.68
52 0.64
53 0.62
54 0.58
55 0.5
56 0.49