Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JT21

Protein Details
Accession A0A0D8JT21   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRHRSRKKRGPVRPLTWSPGBasic
NLS Segment(s)
PositionSequence
2-12KRHRSRKKRGP
Subcellular Location(s) mito 11, plas 6, E.R. 3, golg 3, nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cim:CIMG_12841  -  
Amino Acid Sequences MKRHRSRKKRGPVRPLTWSPGLVYQHCAISAFQRRPALLFFFFFSFLAFCGWLSSSSGGADYRSLFHAQDSRRLVGKEKGALESRSRSQVCWNQTSFVLVSVKKISGGSRAEIQWTGEEGGRKNMQRVFPLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.82
3 0.77
4 0.69
5 0.6
6 0.5
7 0.46
8 0.42
9 0.33
10 0.31
11 0.26
12 0.23
13 0.23
14 0.22
15 0.16
16 0.2
17 0.28
18 0.27
19 0.3
20 0.32
21 0.32
22 0.32
23 0.34
24 0.3
25 0.23
26 0.22
27 0.18
28 0.17
29 0.18
30 0.16
31 0.14
32 0.1
33 0.09
34 0.09
35 0.07
36 0.06
37 0.06
38 0.07
39 0.07
40 0.08
41 0.08
42 0.07
43 0.07
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.09
52 0.08
53 0.09
54 0.14
55 0.14
56 0.21
57 0.22
58 0.22
59 0.24
60 0.24
61 0.27
62 0.26
63 0.28
64 0.25
65 0.24
66 0.26
67 0.27
68 0.28
69 0.28
70 0.28
71 0.27
72 0.31
73 0.3
74 0.27
75 0.32
76 0.36
77 0.39
78 0.41
79 0.39
80 0.34
81 0.33
82 0.35
83 0.27
84 0.24
85 0.22
86 0.16
87 0.18
88 0.18
89 0.18
90 0.17
91 0.18
92 0.16
93 0.19
94 0.21
95 0.21
96 0.23
97 0.24
98 0.25
99 0.25
100 0.26
101 0.21
102 0.2
103 0.2
104 0.17
105 0.2
106 0.19
107 0.25
108 0.3
109 0.31
110 0.34
111 0.37
112 0.39