Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JRT9

Protein Details
Accession A0A015JRT9    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-30LTNIRLRNVIKKKKDSQCHRTGTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR040976  Pkinase_fungal  
Pfam View protein in Pfam  
PF17667  Pkinase_fungal  
Amino Acid Sequences MLLIFVLTNIRLRNVIKKKKDSQCHRTGTLPFMAIEILKHNAEHTFQHDLESFFYVLCWICCEYEGSRGKLRASDCGRKNLMKWVEGSPETIGTIKSGMILDFERDILETPSIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.47
3 0.53
4 0.62
5 0.7
6 0.77
7 0.86
8 0.85
9 0.85
10 0.84
11 0.81
12 0.75
13 0.71
14 0.63
15 0.56
16 0.48
17 0.39
18 0.29
19 0.23
20 0.2
21 0.14
22 0.12
23 0.11
24 0.11
25 0.1
26 0.1
27 0.1
28 0.11
29 0.12
30 0.13
31 0.14
32 0.17
33 0.17
34 0.18
35 0.19
36 0.19
37 0.19
38 0.19
39 0.15
40 0.1
41 0.1
42 0.09
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.08
50 0.09
51 0.17
52 0.21
53 0.23
54 0.25
55 0.27
56 0.27
57 0.29
58 0.29
59 0.29
60 0.32
61 0.38
62 0.38
63 0.44
64 0.48
65 0.46
66 0.46
67 0.46
68 0.43
69 0.35
70 0.35
71 0.3
72 0.32
73 0.31
74 0.32
75 0.24
76 0.21
77 0.2
78 0.18
79 0.15
80 0.1
81 0.1
82 0.08
83 0.09
84 0.09
85 0.08
86 0.1
87 0.1
88 0.12
89 0.12
90 0.12
91 0.11
92 0.11
93 0.13
94 0.13